Crystal structure of human CHD1 tandem chromodomain in complex with the ethoxyquinoline-based inhibitor 2n. Determined by X-ray diffraction at 1.45 Å resolution. Released 20 May 2026.
Explore 9T9H in 3D Show helices and sheets RCSB PDB PDBe
9T9H contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 273 | 1 | 1 |
| β-strand | 274-284 | 11 | 2 |
| α-helix | 289-292 | 4 | |
| α-helix | 294-300 | 7 | |
| β-strand | 314-322 | 9 | 2 |
| α-helix | 327-329 | 3 | |
| β-strand | 331-333 | 3 | 2 |
| α-helix | 335-340 | 6 | |
| β-strand | 344 | 1 | 1 |
| α-helix | 347-365 | 19 | |
| α-helix | 368-387 | 20 | |
| β-strand | 391-397 | 7 | 3 |
| β-strand | 408-413 | 6 | 3 |
| α-helix | 418-420 | 3 | |
| β-strand | 422-425 | 4 | 3 |
| α-helix | 426-432 | 7 | |
| α-helix | 434-441 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromodomain-helicase-DNA-binding protein 1 | A | protein | 174 | Homo sapiens | O14646 (AlphaFold model) |
>9T9H_1 Chromodomain-helicase-DNA-binding protein 1 (chains A) EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIH NTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQ IVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1JUP | 7-ethoxy-2-[4-[(4-methoxyphenyl)methylamino]piperidin-1-yl]-~{N}-[1-(phenylmeth… | C36 H45 N5 O2 | 1 |
Water and common crystallization additives (EDO, DMS) are not listed.
Development of High-Affinity CHD1 Chromodomain Inhibitors. Greschik, H., Friedrich, F., Seifert, L. et al. J Med Chem (2026) 69:12020-12047. DOI 10.1021/acs.jmedchem.5c03690 · PubMed
Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9T9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.