2B3O: Human tyrosine phosphatase SHP-1

Crystal structure of human tyrosine phosphatase SHP-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Oct 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,062
Mol. weight: 60.35 kDa
Released: 25 Oct 2005

Explore 2B3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B3O contains 16 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	11-21	11
β-strand	26-31	6	1
β-strand	38-45	8	1
β-strand	48-55	8	1
β-strand	61-63	3	1
β-strand	68-69	2	1
α-helix	72-80	9
β-strand	86	1	2
β-strand	94	1	2
β-strand	98-99	2	1
α-helix	105-107	3
β-strand	111	1	3
α-helix	117-127	11
β-strand	132-137	6	3
β-strand	145-154	10	3
β-strand	162-169	8	3
β-strand	170	1	4
β-strand	176	1	5
β-strand	177	1	4
β-strand	184	1	5
α-helix	187-197	11
β-strand	199-200	2	6
β-strand	206-207	2	6
β-strand	211-212	2	3
α-helix	221-223	3
α-helix	245-252	8
α-helix	264-266	3
α-helix	270-273	4
β-strand	286	1	7
β-strand	304-307	4	7
β-strand	321-324	4	7
α-helix	332-342	11
β-strand	346-349	4	7
β-strand	354-355	2	8
β-strand	358-359	2	8
β-strand	371-373	3	7
β-strand	378-386	9	7
β-strand	390-398	9	7
α-helix	400-402	3
β-strand	407-414	8	7
α-helix	427-442	16
α-helix	448	1
β-strand	449-452	4	7
α-helix	459-475	17
α-helix	484-491	8
α-helix	502-519	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase, non-receptor type 6	A	protein	532	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2B3O_1 Tyrosine-protein phosphatase, non-receptor type 6 (chains A)
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQ

Primary citation

Crystal structure of human protein-tyrosine phosphatase SHP-1. Yang, J., Liu, L., He, D. et al. J Biol Chem (2003) 278:6516-6520. DOI 10.1074/jbc.M210430200 · PubMed

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 2B3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.