SHP-1 catalytic domain WPD loop closed. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Apr 2013.
Explore 4HJQ in 3D Show helices and sheets RCSB PDB PDBe
4HJQ contains 28 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 244-255 | 12 | |
| α-helix | 263-266 | 4 | |
| α-helix | 268-273 | 6 | |
| α-helix | 283-285 | 3 | |
| β-strand | 286-288 | 3 | 1 |
| α-helix | 289-290 | 2 | |
| β-strand | 301-307 | 7 | 1 |
| β-strand | 321-324 | 4 | 1 |
| α-helix | 325-328 | 4 | |
| α-helix | 329-331 | 3 | |
| α-helix | 332-341 | 10 | |
| β-strand | 346-349 | 4 | 1 |
| β-strand | 354-355 | 2 | 2 |
| β-strand | 358-359 | 2 | 2 |
| α-helix | 366-367 | 2 | |
| β-strand | 371-374 | 4 | 1 |
| β-strand | 377-386 | 10 | 1 |
| β-strand | 390-399 | 10 | 1 |
| β-strand | 407-414 | 8 | 1 |
| α-helix | 427-441 | 15 | |
| α-helix | 448 | 1 | |
| β-strand | 449-452 | 4 | 1 |
| α-helix | 459-476 | 18 | |
| α-helix | 484-492 | 9 | |
| α-helix | 502-522 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 244-256 | 13 | |
| α-helix | 268-273 | 6 | |
| α-helix | 283-285 | 3 | |
| β-strand | 286 | 1 | 3 |
| α-helix | 287-289 | 3 | |
| β-strand | 304-308 | 5 | 3 |
| α-helix | 314-316 | 3 | |
| β-strand | 320-324 | 5 | 3 |
| α-helix | 325-328 | 4 | |
| α-helix | 329-331 | 3 | |
| α-helix | 332-341 | 10 | |
| β-strand | 346-349 | 4 | 3 |
| β-strand | 354-355 | 2 | 4 |
| β-strand | 358-359 | 2 | 4 |
| α-helix | 366-367 | 2 | |
| β-strand | 371-374 | 4 | 3 |
| β-strand | 377-386 | 10 | 3 |
| β-strand | 390-399 | 10 | 3 |
| β-strand | 407-414 | 8 | 3 |
| α-helix | 427-442 | 16 | |
| α-helix | 448 | 1 | |
| β-strand | 449-452 | 4 | 3 |
| α-helix | 458-476 | 19 | |
| α-helix | 484-492 | 9 | |
| α-helix | 502-521 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase non-receptor type 6 | A, B | protein | 308 | Homo sapiens | P29350 (AlphaFold model) |
>4HJQ_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A, B) MHHHHHHGSLVPRSENLYFQGSGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNIL PFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAW QENSRVIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPL DNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHSSAGIGRT GTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTK KKLEVLQS
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 2 |
SHP Family Protein Tyrosine Phosphatases Adopt Canonical Active-Site Conformations in the Apo and Phosphate-Bound States. Alicea-Velazquez, N.L., Boggon, T.J. Protein Pept Lett (2013) 20:1039-1048. PubMed
Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HJQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.