4GRY: SHP1 catalytic domain with SO4

Crystal structure of SHP1 catalytic domain with SO4. Determined by X-ray diffraction at 1.7 Å resolution. Released 19 Dec 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,466
Mol. weight: 33.11 kDa
Released: 19 Dec 2012

Explore 4GRY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GRY contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	244-253	10
α-helix	263-266	4
α-helix	268-273	6
α-helix	283-285	3
β-strand	286-288	3	1
α-helix	289	1
β-strand	301-307	7	1
β-strand	321-325	5	1
α-helix	326-328	3
α-helix	329-331	3
α-helix	332-341	10
β-strand	346-349	4	1
α-helix	366-367	2
β-strand	371-374	4	1
β-strand	377-386	10	1
β-strand	390-399	10	1
β-strand	407-414	8	1
α-helix	417-418	2
α-helix	427-441	15
α-helix	448	1
β-strand	449-453	5	1
α-helix	458-476	19
α-helix	484-492	9
α-helix	502-523	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A	protein	288	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GRY_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A)
GSGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHSSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQS

Primary citation

Structure-guided studies of the SHP-1/JAK1 interaction provide new insights into phosphatase catalytic domain substrate recognition. Alicea-Velazquez, N.L., Jakoncic, J., Boggon, T.J. J Struct Biol (2013) 181:243-251. DOI 10.1016/j.jsb.2012.12.009 · PubMed

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 4GRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.