6SM5: MbC/SHP1-C-SH2 complex

MbC/SHP1-C-SH2 complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 13 Jan 2021.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,557
Mol. weight: 23.26 kDa
Released: 13 Jan 2021

Explore 6SM5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SM5 contains 4 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	1
α-helix	20-29	10
β-strand	35-40	6	1
β-strand	48-57	10	1
α-helix	64	1
β-strand	65-72	8	1
β-strand	73-75	3	2
β-strand	78-80	3	2
β-strand	87	1	2
α-helix	90-100	11
β-strand	102-105	4	3
β-strand	108-110	3	3
β-strand	114-115	2	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-16	8	4
β-strand	19-25	7	4
β-strand	33-40	8	5
β-strand	45-46	2	1
β-strand	47-52	6	5
β-strand	57-61	5	4
α-helix	63-64	2
β-strand	68-76	9	5
β-strand	86-92	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A	protein	120	Homo sapiens	P29350 (AlphaFold model)
MbC (monobody targeting SHP1-C-SH2)	B	protein	93	synthetic construct

Sequence of entity 1 (A), FASTA

>6SM5_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A)
GSLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAG
PGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYKEK

Sequence of entity 2 (B), FASTA

>6SM5_2 MbC (monobody targeting SHP1-C-SH2) (chains B)
GSVSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYPGYQEFEVPGSKSTATI
SGLKPGVDYTITVYAGFTDQYYYGSPISINYRT

Primary citation

MbC/SHP1-C-SH2 complex. Hantschel, O. To be published.

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 6SM5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.