8YHI: SHP1 from Biortus

The Crystal Structure of SHP1 from Biortus. Determined by X-ray diffraction at 1.75 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,470
Mol. weight: 33.23 kDa
Released: 13 Mar 2024

Explore 8YHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YHI contains 14 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	243-254	12
α-helix	263-266	4
α-helix	268-273	6
α-helix	283-285	3
β-strand	286-288	3	1
α-helix	289	1
β-strand	301-308	8	1
β-strand	320-325	6	1
α-helix	329-331	3
α-helix	332-342	11
β-strand	346-349	4	1
β-strand	354	1	2
β-strand	361	1	2
α-helix	366-367	2
β-strand	371-374	4	1
β-strand	377-386	10	1
β-strand	390-399	10	1
β-strand	407-414	8	1
α-helix	417-418	2
α-helix	427-441	15
α-helix	448	1
β-strand	449-453	5	1
α-helix	458-476	19
α-helix	484-492	9
α-helix	502-523	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A	protein	288	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8YHI_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A)
GSGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHSSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQS

Primary citation

The Crystal Structure of SHP1 from Biortus. Wang, F., Cheng, W., Yuan, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 8YHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.