2BBN: Calmodulin

Solution structure of a calmodulin-target peptide complex by multidimensional NMR. Determined by solution NMR. Released 31 Jan 1994.

Method: Solution NMR
Organism: Drosophila melanogaster
Chains: 2
Atoms: 1,378
Mol. weight: 19.83 kDa
Ligands: CA
Released: 31 Jan 1994

Explore 2BBN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BBN contains 9 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-19	13
β-strand	27	1	1
α-helix	29-39	11
α-helix	46-53	8
β-strand	63	1	1
α-helix	65-73	9
α-helix	83-92	10
β-strand	100	1	2
α-helix	102-110	9
α-helix	118-128	11
β-strand	136	1	2
α-helix	139-144	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-19	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	148	Drosophila melanogaster	P62152 (AlphaFold model)
Myosin light chain kinase	B	protein	26		P07313 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BBN_1 CALMODULIN (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE
VDEMIREADIDGDGQVNYEEFVTMMTSK

Sequence of entity 2 (B), FASTA

>2BBN_2 MYOSIN LIGHT CHAIN KINASE (chains B)
KRRWKKNFIAVSAANRFKKISSSGAL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Solution structure of a calmodulin-target peptide complex by multidimensional NMR. Ikura, M., Clore, G.M., Gronenborn, A.M. et al. Science (1992) 256:632-638. PubMed

Other PDB entries of the same protein (UniProt P62152 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MXE 1.7 Å, Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
7CQH 2.15 Å, Complex of TRP_CBS2 and Calmodulin_Clobe
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4CLN 2.2 Å, Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-Å…
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
8ZLW 2.2 Å, Crystal Structure of RDGC IQ motif/dCaM Complex
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4PJJ 2.4 Å, MYOSIN VI (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state - long soaking with PO4
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state

Browse structure collections

About this viewer

MolViewer shows 2BBN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.