Crystal and molecular structure of the serine proteinase inhibitor ci-2 from barley seeds. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Sept 1988.
Explore 2CI2 in 3D Show helices and sheets RCSB PDB PDBe
2CI2 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23 | 1 | 1 |
| α-helix | 25-27 | 3 | |
| β-strand | 31 | 1 | 2 |
| α-helix | 32-42 | 11 | |
| β-strand | 47-52 | 6 | 1 |
| α-helix | 55-58 | 4 | |
| β-strand | 65-70 | 6 | 1 |
| β-strand | 75 | 1 | 2 |
| β-strand | 76 | 1 | 1 |
| β-strand | 81-82 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chymotrypsin inhibitor 2 | I | protein | 83 | Hordeum vulgare | P01053 (AlphaFold model) |
>2CI2_1 CHYMOTRYPSIN INHIBITOR 2 (chains I) SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTME YRIDRVRLFVDKLDNIAEVPRVG
Crystal and molecular structure of the serine proteinase inhibitor CI-2 from barley seeds. McPhalen, C.A., James, M.N. Biochemistry (1987) 26:261-269. DOI 10.1021/bi00375a036 · PubMed
Other PDB entries of the same protein (UniProt P01053 (AlphaFold model), which also has an AlphaFold model), best resolution first:
2CI2 is part of these collections:
MolViewer shows 2CI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.