2CK2: Core-swapped mutant of fibronectin

Structure of core-swapped mutant of fibronectin. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Apr 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,535
Mol. weight: 20.43 kDa
Ligands: ACE
Released: 10 Apr 2007

Explore 2CK2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CK2 contains 6 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6-13	8	1
β-strand	18-23	6	1
β-strand	31-38	8	2
β-strand	46-51	6	2
β-strand	56-59	4	1
α-helix	62-63	2
β-strand	67-76	10	2
β-strand	83-84	2	2
α-helix	85-87	3
β-strand	88-93	6	2

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	2
β-strand	17-23	7	2
β-strand	31-38	8	1
α-helix	44-45	2
β-strand	46-51	6	1
β-strand	56-60	5	2
α-helix	62-63	2
β-strand	67-75	9	1
β-strand	84	1	1
α-helix	85-87	3
β-strand	88-93	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human fibronectin	A, B	protein	96	HOMO SAPIENS	P02751 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2CK2_1 HUMAN FIBRONECTIN (chains A, B)
VSDVPRDIEVVAVTPTSALISWDAPAVTIRYIRLTYGETGGNSPVQEITLPGSKSTYTIS
GLKPGTDYTVTLYSVTGRGDSPASSKPASINFRTEI

Ligands and cofactors

ID	Name	Formula	Copies
ACE	Acetyl group	C2 H4 O	2

Primary citation

Designing an Extracellular Matrix Protein with Enhanced Mechanical Stability. Ng, S.P., Billings, K.S., Ohashi, T. et al. Proc Natl Acad Sci U S A (2007) 104:9633. DOI 10.1073/PNAS.0609901104 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2CK2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.