2CKZ: RNA polymerase III subcomplex C17-C25

X-ray structure of RNA polymerase III subcomplex C17-C25. Determined by X-ray diffraction at 3.2 Å resolution. Released 13 Jul 2006.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 4,386
Mol. weight: 87.63 kDa
Released: 13 Jul 2006

Explore 2CKZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CKZ contains 20 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-11	10	1
α-helix	12	1
α-helix	13-26	14
α-helix	31-35	5
α-helix	53-66	14

Chain B: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	1
α-helix	15-17	3
α-helix	22-34	13
β-strand	37-39	3	1
β-strand	43-54	12	1
β-strand	58-59	2	1
α-helix	60	1
α-helix	65	1
β-strand	66-77	12	1
β-strand	84-93	10	2
β-strand	96-100	5	2
β-strand	108-111	4	2
β-strand	120-122	3	3
β-strand	127-131	5	3
β-strand	137-140	4	3
β-strand	145-155	11	2
β-strand	194-199	6	2
β-strand	206-207	2	2
α-helix	208-210	3

Chain C: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-11	9	4
α-helix	13-26	14
α-helix	31-36	6
α-helix	55-65	11
α-helix	100-111	12
α-helix	117-125	9
α-helix	131-135	5
α-helix	147-158	12

Chain D: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	4
α-helix	22-34	13
β-strand	38-39	2	4
β-strand	43-53	11	4
β-strand	54	1	1
β-strand	68-77	10	4
β-strand	84-93	10	5
β-strand	96-101	6	5
β-strand	103	1	5
β-strand	105-111	7	5
α-helix	112-114	3
β-strand	120-122	3	6
α-helix	123-125	3
β-strand	127-131	5	6
β-strand	137-140	4	6
β-strand	145-155	11	5
β-strand	194-199	6	5
β-strand	206-207	2	5
α-helix	208-210	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase III 18 kd polypeptide	A, C	protein	161	SACCHAROMYCES CEREVISIAE	P47076 (AlphaFold model)
DNA-directed RNA polymerase III 25 kd polypeptide	B, D	protein	218	SACCHAROMYCES CEREVISIAE	P35718 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2CKZ_1 DNA-DIRECTED RNA POLYMERASE III 18 KD POLYPEPTIDE (chains A, C)
MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITR
NVVNYLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEK
LQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISAYA

Sequence of entity 2 (B, D), FASTA

>2CKZ_2 DNA-DIRECTED RNA POLYMERASE III 25 KD POLYPEPTIDE (chains B, D)
MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLK
PGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCY
YTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKPKSPKERELEERAQLENEIEG
KNEETPQNEKPPAYALLGSCQTDGMGLVSWWEHHHHHH

Primary citation

Structural Biology of RNA Polymerase III: Subcomplex C17/-C25 X-Ray Structure and 11-Subunit Enzyme Model. Jasiak, A.J., Armache, K.-J., Martens, B. et al. Mol Cell (2006) 23:71. DOI 10.1016/J.MOLCEL.2006.05.013 · PubMed

Other PDB entries of the same protein (UniProt P47076 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z0H 2.6 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.6 A (focus subunit AC40).
7Z1O 2.7 Å, Structure of yeast RNA Polymerase III PTC + NTPs
7Z31 2.76 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.7 A (focus subunit C11,…
7Z1L 2.8 Å, Structure of yeast RNA Polymerase III Pre-Termination Complex (PTC)
7Z30 2.9 Å, Structure of yeast RNA Polymerase III-Ty1 integrase complex at 2.9 A (focus subunit C11…
7Z2Z 3.07 Å, Structure of yeast RNA Polymerase III-DNA-Ty1 integrase complex (Pol III-DNA-IN1) at 3.1 A
8BWS 3.2 Å, Structure of yeast RNA Polymerase III elongation complex at 3.3 A
6TUT 3.25 Å, Cryo-EM structure of the RNA Polymerase III-Maf1 complex
6EU3 3.3 Å, Apo RNA Polymerase III - closed conformation (cPOL3)
6EU1 3.4 Å, RNA Polymerase III - open DNA complex (OC-POL3).
6EU2 3.4 Å, Apo RNA Polymerase III - open conformation (oPOL3)
7Z1M 3.4 Å, Structure of yeast RNA Polymerase III Elongation Complex (EC)

Browse structure collections

About this viewer

MolViewer shows 2CKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.