2COL: Bifunctional hemolysin-adenylate cyclase

Crystal structure analysis of CyaA/C-Cam with Pyrophosphate. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Jan 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Bordetella pertussis, Xenopus laevis
Chains: 2
Atoms: 3,345
Mol. weight: 46.61 kDa
Ligands: MG, POP, CA
Released: 24 Jan 2006

Explore 2COL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2COL contains 21 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
α-helix	21-33	13
β-strand	36-40	5	1
α-helix	41-44	4
α-helix	45-53	9
α-helix	55	1
β-strand	56-57	2	2
α-helix	58	1
β-strand	77	1	3
α-helix	90-105	16
β-strand	109-112	4	3
β-strand	114-115	2	4
α-helix	117-126	10
α-helix	142-145	4
β-strand	147-152	6	4
β-strand	159-165	7	4
β-strand	172-173	2	4
β-strand	175-178	4	3
β-strand	184	1	3
β-strand	185-186	2	2
β-strand	191-196	6	1
β-strand	197	1	5
α-helix	198-201	4
α-helix	202-209	8
α-helix	215-222	8
α-helix	235-252	18
α-helix	256-259	4
β-strand	263-264	2	6
β-strand	267-268	2	6
α-helix	274-289	16
α-helix	301-303	3
β-strand	313-316	4	1
β-strand	322-325	4	1
α-helix	327-339	13
β-strand	342	1	5

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	82-92	11
β-strand	100	1	7
α-helix	102-111	10
α-helix	118-128	11
β-strand	136	1	7
α-helix	138-142	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bifunctional hemolysin-adenylate cyclase	A	protein	356	Bordetella pertussis	P0DKX7 (AlphaFold model)
Calmodulin	B	protein	67	Xenopus laevis	P0DP33 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2COL_1 Bifunctional hemolysin-adenylate cyclase (chains A)
AGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSLIAEGVATKGLGVHAKS
SDWGLQAGYIPVNPNLSKLFGRAPEVIARADNDVNSSLAHGHTAVDLTLSKERLDYLRQA
GLVTGMADGVVASNHAGYEQFEFRVKETSDGRYAVQYRRKGGDDFEAVKVIGNAAGIPLT
ADIDMFAIMPHLSNFRDSARSSVTSGDSVTDYLARTRRAASEATGGLDRERIDLLWKIAR
AGARSAVGTEARRQFRYDGDMNIGVITDFELEVRNALNRRAHAVGAQDVVQHGTEQNNPF
PEADEKIFVVSATGESQMLTRGQLKEYIGQQRGEGYVFYENRAYGVAGKSLFDDGL

Sequence of entity 2 (B), FASTA

>2COL_2 Calmodulin (chains B)
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY
EEFVQMM

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
POP	Pyrophosphate 2-	H2 O7 P2	1
CA	Calcium ion	Ca	2

Primary citation

Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin. Guo, Q., Shen, Y., Lee, Y.S. et al. EMBO J (2005) 24:3190-3201. DOI 10.1038/sj.emboj.7600800 · PubMed

Other PDB entries of the same protein (UniProt P0DKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CXL 1.45 Å, Crystal structure of rtx domain block V of adenylate cyclase toxin from bordetella…
9P0D 1.5 Å, Crystal structure of Sr2+-bound RTX domain block V of adenylate cyclase toxin from…
9P0C 1.7 Å, Crystal structure of Ca2+-bound RTX domain block V of adenylate cyclase toxin from…
6SUS 1.76 Å, Crystal structure of RTX domain blocks IV and V of adenylate cyclase toxin from…
9P6C 1.99 Å, RTX domain block V of adenylate cyclase toxin with mutations D1533N, A1542N, D1560N,…
1YRT 2.1 Å, Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase…
1ZOT 2.2 Å, crystal structure analysis of the CyaA/C-Cam with PMEAPP
1YRU 2.5 Å, Crystal Structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase…
7RAH 2.6 Å, Adenylate cyclase toxin RTX domain fragment bound to M1H5 Fab and M2B10 Fab
7USL 2.7 Å, Integrin alphaM/beta2 ectodomain in complex with adenylate cyclase toxin RTX751 and M1F5…
6YNU 3.12 Å, CaM-P458 complex (crystal form 1)
6YNS 3.94 Å, CaM-P458 complex (crystal form 2)

Browse structure collections

About this viewer

MolViewer shows 2COL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.