2CP8: Next to BRCA1 gene 1 protein

Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant. Determined by solution NMR. Released 19 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 406
Mol. weight: 5.83 kDa
Released: 19 Nov 2005

Explore 2CP8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CP8 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-19	11
α-helix	24-31	8
α-helix	38-48	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Next to BRCA1 gene 1 protein	A	protein	54	Homo sapiens	Q14596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CP8_1 Next to BRCA1 gene 1 protein (chains A)
GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG

Primary citation

Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant. Ohashi, W., Hirota, H., Yamazaki, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BKF 1.56 Å, Structure of the PB1 domain of NBR1
2G4S 2.15 Å, Anomalous substructure of NBR1PB1
4OLE 2.52 Å, Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A…
1WJ6 Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
2L8J GABARAPL-1 NBR1-LIR complex structure
2MGW Solution Structure of the UBA Domain of Human NBR1
2MJ5 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2CP8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.