2L8J: GABARAPL-1 NBR1-LIR complex structure

GABARAPL-1 NBR1-LIR complex structure. Determined by solution NMR. Released 11 May 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,138
Mol. weight: 16.11 kDa
Released: 11 May 2011

Explore 2L8J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L8J contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-80	4	1
β-strand	83	1	1
β-strand	90	1	2
α-helix	91-97	7
β-strand	105-110	6	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	729-730	2
β-strand	733-734	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A	protein	119	Homo sapiens	Q9H0R8 (AlphaFold model)
NBR1-LIR peptide	B	protein	18	Homo sapiens	Q14596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L8J_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A)
GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLT
VGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVY

Sequence of entity 2 (B), FASTA

>2L8J_2 NBR1-LIR peptide (chains B)
GAMGSASSEDYIIILPES

Primary citation

Characterization of the Interaction of GABARAPL-1 with the LIR Motif of NBR1. Rozenknop, A., Rogov, V.V., Rogova, N.Y. et al. J Mol Biol (2011) 410:477-487. DOI 10.1016/j.jmb.2011.05.003 · PubMed

Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YOO 1.06 Å, Structure of SAMM50 LIR bound to GABARAPL1
6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
6HOL 1.4 Å, Structure of ATG14 LIR motif bound to GABARAPL1
5LXI 1.44 Å, GABARAP-L1 ATG4B LIR Complex
7AA7 1.45 Å, Structure of SCOC pS12/pS18 LIR motif bound to GABARAPL1
8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1
5LXH 1.58 Å, GABARAP-L1 ATG4B LIR Complex
2R2Q 1.65 Å, Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1…
7AA9 1.72 Å, Structure of SCOC pT13/pT15 LIR motif bound to GABARAPL1
9JF2 1.76 Å, Crystal structure of GABARAPL1 in complex with ATG16L1
7JHX 1.91 Å, Crystal structure of hEPG5 LIR/GABARAPL1 complex
9HGC 2.52 Å, Crystal structure of human GABARAPL1 in complex with cyclic peptide GAB_D8

Browse structure collections

About this viewer

MolViewer shows 2L8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.