Anomalous substructure of NBR1PB1. Determined by X-ray diffraction at 2.15 Å resolution. Released 20 Feb 2007.
Explore 2G4S in 3D Show helices and sheets RCSB PDB PDBe
2G4S contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-11 | 7 | 1 |
| β-strand | 14-20 | 7 | 1 |
| α-helix | 23-25 | 3 | |
| α-helix | 28-39 | 12 | |
| β-strand | 44-49 | 6 | 1 |
| β-strand | 55-58 | 4 | 1 |
| α-helix | 61-73 | 13 | |
| β-strand | 77-84 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Next to BRCA1 gene 1 protein | A | protein | 86 | Homo sapiens | Q14596 (AlphaFold model) |
>2G4S_1 Next to BRCA1 gene 1 protein (chains A) AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSIN SQGEYEEALKMAVKQGNQLQMQVHEG
On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths. Mueller-Dieckmann, C., Panjikar, S., Schmidt, A. et al. Acta Crystallogr D Biol Crystallogr (2007) 63:366-380. DOI 10.1107/S0907444906055624 · PubMed
Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.