4OLE: Next to BRCA1 gene 1 protein

Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A resolution. Determined by X-ray diffraction at 2.52 Å resolution. Released 19 Feb 2014.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,587
Mol. weight: 56.32 kDa
Released: 19 Feb 2014

Explore 4OLE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OLE contains 13 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	365-366	2	1
β-strand	373-378	6	2
β-strand	384-386	3	3
β-strand	391-400	10	2
β-strand	410-417	8	3
α-helix	419	1
β-strand	420-421	2	2
α-helix	425-428	4
β-strand	429-430	2	2
α-helix	434-435	2
β-strand	439-447	9	2
β-strand	453-463	11	3
β-strand	466-478	13	3
α-helix	479-483	5

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	365-366	2	3
β-strand	373-378	6	4
β-strand	384-386	3	1
β-strand	391-400	10	4
β-strand	410-417	8	1
α-helix	419	1
β-strand	420-421	2	4
α-helix	434-435	2
β-strand	439-447	9	4
β-strand	453-463	11	1
β-strand	466-478	13	1

Chain C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	373-378	6	5
β-strand	384-386	3	6
β-strand	391-400	10	5
β-strand	410-417	8	6
α-helix	419	1
β-strand	420-421	2	5
α-helix	425-428	4
β-strand	430	1	5
α-helix	434-435	2
β-strand	439-447	9	5
β-strand	453-463	11	6
β-strand	466-478	13	6

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	373-378	6	7
β-strand	384-386	3	8
β-strand	391-400	10	7
β-strand	410-417	8	8
α-helix	419	1
β-strand	420-421	2	7
α-helix	427-429	3
β-strand	430	1	8
α-helix	434-435	2
β-strand	439-447	9	7
β-strand	453-463	11	8
β-strand	466-478	13	8
α-helix	479-481	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Next to BRCA1 gene 1 protein	A, B, C, D	protein	122	Homo sapiens	Q14596 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4OLE_1 Next to BRCA1 gene 1 protein (chains A, B, C, D)
GTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLAS
TEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPS
EE

Primary citation

Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A resolution. Joint Center for Structural Genomics (JCSG). To be published.

Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BKF 1.56 Å, Structure of the PB1 domain of NBR1
2G4S 2.15 Å, Anomalous substructure of NBR1PB1
1WJ6 Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
2CP8 Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1…
2L8J GABARAPL-1 NBR1-LIR complex structure
2MGW Solution Structure of the UBA Domain of Human NBR1
2MJ5 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 4OLE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.