Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian. Determined by solution NMR. Released 6 Jun 2006.
Explore 2D8I in 3D Show helices and sheets RCSB PDB PDBe
2D8I contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15-22 | 8 | 1 |
| β-strand | 34-40 | 7 | 1 |
| β-strand | 43-50 | 8 | 1 |
| α-helix | 57-60 | 4 | |
| β-strand | 68-71 | 4 | 1 |
| β-strand | 75 | 1 | 1 |
| α-helix | 76-78 | 3 | |
| α-helix | 81-88 | 8 | |
| β-strand | 92-99 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-cell lymphoma invasion and metastasis 1 variant | A | protein | 114 | Homo sapiens | Q13009 (AlphaFold model) |
>2D8I_1 T-cell lymphoma invasion and metastasis 1 variant (chains A) GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKK GLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian. Qin, X.R., Hayashi, F., Yokoyama, S. To be published.
Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2D8I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.