Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple Mutant (QM). Determined by X-ray diffraction at 2.3 Å resolution. Released 13 May 2015.
Explore 4NXP in 3D Show helices and sheets RCSB PDB PDBe
4NXP contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 842-849 | 8 | 1 |
| β-strand | 860-865 | 6 | 1 |
| β-strand | 872-878 | 7 | 1 |
| α-helix | 883-886 | 4 | |
| β-strand | 894-898 | 5 | 1 |
| β-strand | 901-902 | 2 | 1 |
| α-helix | 903-905 | 3 | |
| α-helix | 908-916 | 9 | |
| β-strand | 919-926 | 8 | 1 |
| α-helix | 927-929 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-lymphoma invasion and metastasis-inducing protein 1 | A | protein | 94 | Homo sapiens | Q13009 (AlphaFold model) |
>4NXP_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A) GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEIL EINNRAADALNSSMMEDFFSQPSVGLLVRTYPEL
Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions. Liu, X., Speckhard, D.C., Shepherd, T.R. et al. Structure (2016) 24:2053-2066. DOI 10.1016/j.str.2016.08.019 · PubMed
Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.