Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in Complex With SSRKEYYA Peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Apr 2010.
Explore 3KZE in 3D Show helices and sheets RCSB PDB PDBe
3KZE contains 11 α-helices and 20 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 842-849 | 8 | 1 |
| β-strand | 860-867 | 8 | 1 |
| β-strand | 870-878 | 9 | 1 |
| α-helix | 883-886 | 4 | |
| β-strand | 894-898 | 5 | 1 |
| β-strand | 901-902 | 2 | 1 |
| α-helix | 903-905 | 3 | |
| α-helix | 908-914 | 7 | |
| β-strand | 919-926 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 842-849 | 8 | 2 |
| α-helix | 850-852 | 3 | |
| β-strand | 860-867 | 8 | 2 |
| β-strand | 870-878 | 9 | 2 |
| α-helix | 883-886 | 4 | |
| β-strand | 894-898 | 5 | 2 |
| β-strand | 901-902 | 2 | 2 |
| α-helix | 903-905 | 3 | |
| α-helix | 908-916 | 9 | |
| β-strand | 919-926 | 8 | 2 |
| α-helix | 927-929 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 842-849 | 8 | 3 |
| β-strand | 860-865 | 6 | 3 |
| β-strand | 872-878 | 7 | 3 |
| α-helix | 883-887 | 5 | |
| β-strand | 894-898 | 5 | 3 |
| β-strand | 901-902 | 2 | 3 |
| α-helix | 903-905 | 3 | |
| α-helix | 908-916 | 9 | |
| β-strand | 919-926 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-7 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-lymphoma invasion and metastasis-inducing protein 1 | A, B, C | protein | 94 | Homo sapiens | Q13009 (AlphaFold model) |
| Synthetic Peptide | D, E | protein | 8 |
>3KZE_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A, B, C) GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEIL EINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL
>3KZE_2 Synthetic Peptide (chains D, E) SSRKEYYA
The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion. Shepherd, T.R., Klaus, S.M., Liu, X. et al. J Mol Biol (2010) 398:730-746. DOI 10.1016/j.jmb.2010.03.047 · PubMed
Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.