2DBF: Nuclear factor NF-kappa-B p105 subunit

Solution structure of the Death domain in human Nuclear factor NF-kappa-B p105 subunit. Determined by solution NMR. Released 19 Dec 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 744
Mol. weight: 10.62 kDa
Released: 19 Dec 2006

Explore 2DBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DBF contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	33-40	8
α-helix	43-45	3
α-helix	46-51	6
α-helix	55-65	11
α-helix	70-80	11
α-helix	84-93	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor NF-kappa-B p105 subunit	A	protein	100	Homo sapiens	P19838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DBF_1 Nuclear factor NF-kappa-B p105 subunit (chains A)
GSSGSSGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLM
DNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSSGPSSG

Primary citation

Solution structure of the Death domain in human Nuclear factor NF-kappa-B p105 subunit. Saito, K., Inoue, M., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P19838 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8TQD 2.02 Å, NF-Kappa-B1 Bound with a Covalent Inhibitor
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
7LEQ 2.24 Å, Structure of importin a2 bound to p50 NLS
7LET 2.4 Å, Structure of importin a2 bound to the p50- and p65-NLSs
1SVC 2.6 Å, Nfkb P50 homodimer bound to DNA
7RG4 2.6 Å, Importin alpha2 in complex with p50 NLS
1NFI 2.7 Å, I-kappa-B-alpha/nf-kappa-B complex
2O61 2.8 Å, Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer
7LF4 2.85 Å, Structure of importin a3 bound to the p50- and p65-NLSs
3GUT 3.59 Å, Crystal structure of a higher-order complex of p50:RelA bound to the HIV-1 LTR
1MDI High resolution solution NMR structure of mixed disulfide intermediate between mutant…

Browse structure collections

About this viewer

MolViewer shows 2DBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.