Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1. Determined by solution NMR. Released 26 Feb 2008.
Explore 2ECZ in 3D Show helices and sheets RCSB PDB PDBe
2ECZ contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 23 | 1 | 1 |
| β-strand | 31 | 1 | 2 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 61-63 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorbin and SH3 domain-containing protein 1 | A | protein | 70 | Homo sapiens | Q9BX66 (AlphaFold model) |
>2ECZ_1 Sorbin and SH3 domain-containing protein 1 (chains A) GSSGSSGGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITY VDVISGPSSG
Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1. Abe, H., Miyamoto, K., Tochio, N. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ECZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.