2EEI: PDZ domain-containing protein 1

Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1. Determined by solution NMR. Released 26 Feb 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 793
Mol. weight: 11.36 kDa
Released: 26 Feb 2008

Explore 2EEI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EEI contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	25-26	2	2
α-helix	27-28	2
β-strand	35-36	2	2
α-helix	44-48	5
β-strand	54-55	2	2
β-strand	56-59	4	1
β-strand	62-63	2	1
α-helix	69-79	11
β-strand	82-87	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ domain-containing protein 1	A	protein	106	Homo sapiens	Q5T2W1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EEI_1 PDZ domain-containing protein 1 (chains A)
GSSGSSGQPRLCYLVKEGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVN
GENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKSGPSSG

Primary citation

Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1. Niraula, T.N., Tomizawa, T., Koshiba, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
4Q2P 2.05 Å, NHERF3 PDZ2 in Complex with a Phage-Derived Peptide
2VSP 2.41 Å, Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2EEJ Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1

Browse structure collections

About this viewer

MolViewer shows 2EEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.