4Q2P: NHERF3 PDZ2

NHERF3 PDZ2 in Complex with a Phage-Derived Peptide. Determined by X-ray diffraction at 2.05 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,157
Mol. weight: 32.28 kDa
Released: 10 Sept 2014

Explore 4Q2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Q2P contains 11 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	133	1
β-strand	134-139	6	1
β-strand	141	1	2
β-strand	144	1	2
β-strand	148-150	3	1
β-strand	159-161	3	1
α-helix	168-172	5
β-strand	179-183	5	1
β-strand	186-187	2	1
α-helix	193-202	10
β-strand	206-212	7	1
α-helix	214-217	4
α-helix	219-220	2
β-strand	221-225	5	3

Chain B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	134-139	6	3
β-strand	141	1	4
β-strand	144	1	4
β-strand	148-152	5	3
β-strand	159-161	3	3
α-helix	168-172	5
α-helix	178	1
β-strand	179-183	5	3
β-strand	186-187	2	3
α-helix	193-202	10
β-strand	206-212	7	3
β-strand	223-225	3	5

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	133-139	7	5
β-strand	148-150	3	5
β-strand	159-161	3	5
α-helix	168-172	5
α-helix	178	1
β-strand	179-183	5	5
β-strand	186-187	2	5
α-helix	193-203	11
β-strand	206-212	7	5
β-strand	223-225	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF3	A, B, C	protein	99	Homo sapiens	Q5T2W1 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4Q2P_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (chains A, B, C)
GSHMQPRLCYLVKEGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGEN
VEDASHEEVVEKVKKSGSRVMFLLVDKEAAGGGIKITKF

Primary citation

A structural portrait of the PDZ domain family. Ernst, A., Appleton, B.A., Ivarsson, Y. et al. J Mol Biol (2014) 426:3509-3519. DOI 10.1016/j.jmb.2014.08.012 · PubMed

Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
2VSP 2.41 Å, Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2EEI Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1
2EEJ Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1

Browse structure collections

About this viewer

MolViewer shows 4Q2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.