Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues (VLKSTQF) of human URAT1 transporter (SLC22A12). Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Jan 2026.
Explore 9RXS in 3D Show helices and sheets RCSB PDB PDBe
9RXS contains 5 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 377-382 | 6 | 1 |
| β-strand | 384 | 1 | 2 |
| β-strand | 387 | 1 | 2 |
| β-strand | 391-393 | 3 | 1 |
| β-strand | 402-404 | 3 | 1 |
| α-helix | 406-407 | 2 | |
| α-helix | 411-414 | 4 | |
| β-strand | 422-426 | 5 | 1 |
| β-strand | 429-430 | 2 | 1 |
| α-helix | 436-445 | 10 | |
| β-strand | 449-455 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 376-382 | 7 | 3 |
| β-strand | 384-388 | 5 | 4 |
| β-strand | 391-393 | 3 | 3 |
| β-strand | 402-404 | 3 | 3 |
| α-helix | 411-415 | 5 | |
| β-strand | 422-426 | 5 | 3 |
| β-strand | 429-430 | 2 | 3 |
| α-helix | 436-446 | 11 | |
| β-strand | 449-455 | 7 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3,Solute carrier family 22 member 12 | A, B | protein | 92 | Homo sapiens | Q5T2W1 (AlphaFold model), Q96S37 (AlphaFold model) |
>9RXS_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF3,Solute carrier family 22 member 12 (chains A, B) GKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLD EPYEKVVDRIQSSGKNVTLLVCGKKVLKSTQF
Molecular Determinants of Selective and High-affinity Binding of the Scaffold Protein PDZK1 to the Urate Transporter URAT1. Mymrikov, E.V., Wirth, C., Heinicke, J.I. et al. J Mol Biol (2025) 438:169615-169615. DOI 10.1016/j.jmb.2025.169615 · PubMed
Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9RXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.