2VSP: PDZ domain-containing protein 1

Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1. Determined by X-ray diffraction at 2.41 Å resolution. Released 3 Mar 2009.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,466
Mol. weight: 39.18 kDa
Released: 3 Mar 2009

Explore 2VSP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VSP contains 16 α-helices and 35 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	376-382	7	1
α-helix	383	1
β-strand	384	1	2
β-strand	387	1	2
β-strand	393	1	1
β-strand	396	1	3
β-strand	398	1	3
β-strand	402	1	1
α-helix	411-414	4
α-helix	421	1
β-strand	422-426	5	1
β-strand	429-430	2	1
α-helix	436-443	8
β-strand	449-455	7	1

Chain B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	377-380	4	4
β-strand	384	1	5
β-strand	387	1	5
β-strand	392-395	4	6
β-strand	398-403	6	6
α-helix	411-414	4
α-helix	421	1
β-strand	422	1	6
β-strand	423-426	4	4
β-strand	429-430	2	4
α-helix	436-444	9
β-strand	451-454	4	4

Chain C: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	376-382	7	7
α-helix	383	1
β-strand	384	1	8
β-strand	387	1	8
β-strand	392-394	3	7
β-strand	401-403	3	7
α-helix	406-407	2
α-helix	411-414	4
α-helix	421	1
β-strand	422-426	5	7
β-strand	429-430	2	7
α-helix	436-445	10
β-strand	449-455	7	7

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	376-382	7	9
α-helix	383	1
β-strand	384	1	10
β-strand	387	1	10
β-strand	392-394	3	9
β-strand	401-403	3	9
α-helix	411-414	4
α-helix	421	1
β-strand	422-426	5	9
β-strand	429-430	2	9
α-helix	436-445	10
β-strand	449-455	7	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ domain-containing protein 1	A, B, C, D	protein	91	HOMO SAPIENS	Q5T2W1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2VSP_1 PDZ DOMAIN-CONTAINING PROTEIN 1 (chains A, B, C, D)
SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVL
DEPYEKVVDRIQSSGKNVTLLVCGKKAQDTV

Primary citation

Crystal Structure of the Fourth Pdz Domain of Pdz Domain-Containing Protein 1. Yue, W.W., Shafqat, N., Pilka, E.S. et al. To be published.

Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
4Q2P 2.05 Å, NHERF3 PDZ2 in Complex with a Phage-Derived Peptide
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2EEI Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1
2EEJ Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1

Browse structure collections

About this viewer

MolViewer shows 2VSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.