2EEJ: PDZ domain-containing protein 1

Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1. Determined by solution NMR. Released 26 Feb 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 695
Mol. weight: 9.93 kDa
Released: 26 Feb 2008

Explore 2EEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EEJ contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
β-strand	23-24	2	2
β-strand	33-34	2	3
β-strand	35-36	2	2
α-helix	43-47	5
β-strand	54-55	2	3
β-strand	57-58	2	1
β-strand	62	1	1
α-helix	68-78	11
β-strand	81-86	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ domain-containing protein 1	A	protein	96	Homo sapiens	Q5T2W1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EEJ_1 PDZ domain-containing protein 1 (chains A)
GSSGSSGPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNG
VNVLDEPYEKVVDRIQSSGKNVTLLVCGKKSGPSSG

Primary citation

Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1. Niraula, T.N., Tomizawa, T., Koshiba, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
4Q2P 2.05 Å, NHERF3 PDZ2 in Complex with a Phage-Derived Peptide
2VSP 2.41 Å, Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2EEI Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1

Browse structure collections

About this viewer

MolViewer shows 2EEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.