2EJS: RUH-076, a human CUE domain

Solution structure of RUH-076, a human CUE domain. Determined by solution NMR. Released 25 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 445
Mol. weight: 6.36 kDa
Released: 25 Sept 2007

Explore 2EJS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EJS contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	12-23	12
α-helix	29-39	11
α-helix	42-51	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autocrine motility factor receptor, isoform 2	A	protein	58	Homo sapiens	Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EJS_1 Autocrine motility factor receptor, isoform 2 (chains A)
GSSGSSGASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPF

Primary citation

Solution structure of RUH-076, a human CUE domain. Ruhul Momen, A.Z.M., Kitasaka, S., Hirota, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UKV5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4G3O 1.6 Å, Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78)
3H8K 1.8 Å, Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution
3TIW 1.8 Å, Crystal structure of p97N in complex with the C-terminus of gp78
8T0S 1.95 Å, Crystal structure of UBE2G2 adduct with phenethyl isothiocyanate (PEITC) at the Cys48…
4LAD 2.3 Å, Crystal Structure of the Ube2g2:RING-G2BR complex
3FSH 2.76 Å, Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of…
2LVN Structure of the gp78 CUE domain
2LVO Structure of the gp78CUE domain bound to monubiquitin
2LVP gp78CUE domain bound to the distal ubiquitin of K48-linked diubiquitin
2LVQ gp78CUE domain bound to the proximal ubiquitin of K48-linked diubiquitin
2LXH NMR structure of the RING domain in ubiquitin ligase gp78
2LXP NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its…

Browse structure collections

About this viewer

MolViewer shows 2EJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.