2FHD: Crb2 tandem tudor domains

Crystal structure of Crb2 tandem tudor domains. Determined by X-ray diffraction at 2.4 Å resolution. Released 2 Jan 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Schizosaccharomyces pombe
Chains: 3
Atoms: 3,722
Mol. weight: 53.77 kDa
Ligands: PO4
Released: 2 Jan 2007

Explore 2FHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FHD contains 13 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	362-364	3
β-strand	365-369	5	1
β-strand	377-386	10	1
β-strand	393	1	2
β-strand	395-400	6	1
β-strand	405-409	5	1
β-strand	413-415	3	1
β-strand	423-424	2	3
β-strand	425-426	2	4
β-strand	434-440	7	3
α-helix	449-451	3
β-strand	459-464	6	3
β-strand	467-472	6	3
α-helix	473-475	3
β-strand	476-477	2	4
β-strand	478	1	1
α-helix	480-483	4
α-helix	491-492	2
β-strand	498	1	5

Chain B: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	362-364	3
β-strand	365-369	5	6
β-strand	377-387	11	6
β-strand	394-400	7	6
β-strand	405	1	6
β-strand	408-409	2	6
β-strand	413-415	3	6
β-strand	423-424	2	7
β-strand	425-426	2	8
β-strand	434-435	2	7
β-strand	436-440	5	9
α-helix	449-451	3
β-strand	458-462	5	9
β-strand	469-471	3	9
α-helix	473-475	3
β-strand	476-477	2	8
β-strand	478	1	6
α-helix	480-484	5

Chain C: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	365-369	5	10
β-strand	377-384	8	10
β-strand	387	1	11
β-strand	393	1	5
β-strand	394	1	11
β-strand	397-400	4	10
β-strand	405-406	2	10
β-strand	413-415	3	10
β-strand	423	1	12
β-strand	425-426	2	13
β-strand	435-440	6	12
α-helix	449-451	3
β-strand	459-464	6	12
β-strand	467-472	6	12
α-helix	473-475	3
β-strand	476-477	2	13
β-strand	478	1	10
α-helix	480-483	4
α-helix	494-498	5
β-strand	500	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein rhp9/CRB2	A, B, C	protein	153	Schizosaccharomyces pombe	P87074 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2FHD_1 DNA repair protein rhp9/CRB2 (chains A, B, C)
GHMSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIK
RFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPIS
TIYVAPVNIRRFQGRDLSFSTLKDMKFEETSFL

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	10

Primary citation

Structural basis for the methylation state-specific recognition of histone H4-K20 by 53BP1 and Crb2 in DNA repair. Botuyan, M.V., Lee, J., Ward, I.M. et al. Cell (2006) 127:1361-1373. DOI 10.1016/j.cell.2006.10.043 · PubMed

Other PDB entries of the same protein (UniProt P87074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
4BU1 2.1 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
2VXB 2.3 Å, Structure of the Crb2-BRCT2 domain
2VXC 3.1 Å, Structure of the Crb2-BRCT2 domain complex with phosphopeptide.

Browse structure collections

About this viewer

MolViewer shows 2FHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.