2VXB: Crb2-BRCT2 domain

Structure of the Crb2-BRCT2 domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 Aug 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: SCHIZOSACCHAROMYCES POMBE
Chains: 2
Atoms: 3,617
Mol. weight: 55.22 kDa
Ligands: PR
Released: 12 Aug 2008

Explore 2VXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VXB contains 22 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
α-helix	38-47	10
β-strand	51-52	2	1
α-helix	58-60	3
β-strand	61	1	2
β-strand	77	1	2
α-helix	79-83	5
β-strand	86-90	5	1
α-helix	98-106	9
α-helix	108-109	2
β-strand	110-111	2	1
α-helix	114-122	9
α-helix	129-131	3
β-strand	132	1	1
β-strand	133	1	3
β-strand	134-138	5	4
β-strand	143-146	4	4
α-helix	150-152	3
α-helix	158-164	7
β-strand	173-176	4	5
α-helix	194-206	13
β-strand	210-212	3	5
β-strand	224-226	3	5
β-strand	240-241	2	5
α-helix	243-252	10

Chain B: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	6
α-helix	38-46	9
β-strand	51-52	2	6
α-helix	58-60	3
β-strand	61	1	7
β-strand	71-72	2	8
α-helix	73-75	3
β-strand	77	1	7
α-helix	79-83	5
β-strand	86-90	5	6
α-helix	98-106	9
β-strand	110-111	2	6
α-helix	114-122	9
α-helix	129-131	3
β-strand	132	1	6
β-strand	133	1	4
β-strand	134-138	5	3
β-strand	143-146	4	3
α-helix	150-153	4
β-strand	154	1	9
β-strand	156	1	9
α-helix	158-164	7
β-strand	173-177	5	8
α-helix	193-206	14
β-strand	210-214	5	8
β-strand	224-227	4	8
β-strand	240-241	2	8
α-helix	243-252	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein RHP9	A, B	protein	241	SCHIZOSACCHAROMYCES POMBE	P87074 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VXB_1 DNA REPAIR PROTEIN RHP9 (chains A, B)
LIFDDCVFAFSGPVHEDAYDRSALETVVQDHGGLVLDTGLRPLFNDPFKSKQKKLRHLKP
QKRSKSWNQAFVVSDTFSRKVKYLEALAFNIPCVHPQFIKQCLKMNRVVDFSPYLLASGY
SHRLDCTLSQRIEPFDTTDSLYDRLLARKGPLFGKKILFIIPEAKSWQKKIENTEQGQKA
LAHVYHALALGADVEIRPNVAHLECDLILTMDGNIVDETNCPVVDPEWIVECLISQSDIS
T

Ligands and cofactors

ID	Name	Formula	Copies
PR	Praseodymium ion	Pr	3

Primary citation

Structural and Functional Analysis of the Crb2-Brct2 Domain Reveals Distinct Roles in Checkpoint Signaling and DNA Damage Repair. Kilkenny, M.L., Dore, A., Roe, S.M. et al. Genes Dev (2008) 22:2034. DOI 10.1101/GAD.472808 · PubMed

Other PDB entries of the same protein (UniProt P87074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
4BU1 2.1 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
2FHD 2.4 Å, Crystal structure of Crb2 tandem tudor domains
2VXC 3.1 Å, Structure of the Crb2-BRCT2 domain complex with phosphopeptide.

Browse structure collections

About this viewer

MolViewer shows 2VXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.