2VXC: Crb2-BRCT2 domain complex with phosphopeptide

Structure of the Crb2-BRCT2 domain complex with phosphopeptide. Determined by X-ray diffraction at 3.1 Å resolution. Released 12 Aug 2008.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: SCHIZOSACCHAROMYCES POMBE, HOMO SAPIENS
Chains: 3
Atoms: 3,560
Mol. weight: 56.17 kDa
Ligands: PR
Released: 12 Aug 2008

Explore 2VXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VXC contains 22 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	543-547	5	1
α-helix	558-567	10
β-strand	571-572	2	1
α-helix	578-580	3
β-strand	581	1	2
α-helix	593-595	3
β-strand	597	1	2
α-helix	599-603	5
β-strand	606-610	5	1
α-helix	618-626	9
β-strand	630-631	2	1
α-helix	634-641	8
α-helix	649-651	3
β-strand	652	1	1
β-strand	653	1	3
β-strand	654-658	5	4
β-strand	663-666	4	4
α-helix	667	1
α-helix	678-684	7
β-strand	693-697	5	5
α-helix	714-726	13
β-strand	730-734	5	5
β-strand	744-746	3	5
β-strand	760-761	2	5
α-helix	763-772	10

Chain B: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	543-547	5	6
α-helix	558-567	10
β-strand	571-572	2	6
α-helix	578-580	3
β-strand	581	1	7
β-strand	591-592	2	8
α-helix	593-595	3
β-strand	597	1	7
α-helix	599-603	5
β-strand	606-610	5	6
α-helix	618-626	9
β-strand	630-631	2	6
α-helix	634-641	8
α-helix	649-651	3
β-strand	652	1	6
β-strand	653	1	4
β-strand	654-658	5	3
β-strand	663-666	4	3
α-helix	667	1
α-helix	678-684	7
β-strand	693-697	5	8
α-helix	714-726	13
β-strand	730-734	5	8
β-strand	744-746	3	8
β-strand	760-761	2	8
α-helix	763-772	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein RHP9	A, B	protein	242	SCHIZOSACCHAROMYCES POMBE	P87074 (AlphaFold model)
H2A1 peptide	C	protein	4	HOMO SAPIENS

Sequence of entity 1 (A, B), FASTA

>2VXC_1 DNA REPAIR PROTEIN RHP9 (chains A, B)
QLIFDDCVFAFSGPVHEDAYDRSALETVVQDHGGLVLDTGLRPLFNDPFKSKQKKLRHLK
PQKRSKSWNQAFVVSDTFSRKVKYLEALAFNIPCVHPQFIKQCLKMNRVVDFSPYLLASG
YSHRLDCTLSQRIEPFDTTDSLYDRLLARKGPLFGKKILFIIPEAKSWQKKIENTEQGQK
ALAHVYHALALGADVEIRPNVAHLECDLILTMDGNIVDETNCPVVDPEWIVECLISQSDI
ST

Sequence of entity 2 (C), FASTA

>2VXC_2 H2A1 PEPTIDE (chains C)
SQEL

Ligands and cofactors

ID	Name	Formula	Copies
PR	Praseodymium ion	Pr	4

Primary citation

Structural and Functional Analysis of the Crb2-Brct2 Domain Reveals Distinct Roles in Checkpoint Signaling and DNA Damage Repair. Kilkenny, M.L., Dore, A., Roe, S.M. et al. Genes Dev (2008) 22:2034. DOI 10.1101/GAD.472808 · PubMed

Other PDB entries of the same protein (UniProt P87074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BU0 1.5 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
4BU1 2.1 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Crb2 phosphopeptide
2VXB 2.3 Å, Structure of the Crb2-BRCT2 domain
2FHD 2.4 Å, Crystal structure of Crb2 tandem tudor domains

Browse structure collections

About this viewer

MolViewer shows 2VXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.