2G3K: C-terminal domain of Vps28

Crystal structure of the C-terminal domain of Vps28. Determined by X-ray diffraction at 3.05 Å resolution. Released 27 Jun 2006.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Saccharomyces cerevisiae
Chains: 7
Atoms: 5,446
Mol. weight: 76.67 kDa
Released: 27 Jun 2006

Explore 2G3K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G3K contains 30 α-helices and 12 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-167	18
β-strand	173	1	1
α-helix	174-191	18
α-helix	199-210	12
α-helix	212-213	2
β-strand	217	1	1
α-helix	220-240	21

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-168	19
β-strand	173	1	2
α-helix	174-189	16
α-helix	199-210	12
β-strand	217	1	2
α-helix	220-238	19

Chains C and F: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-168	19
β-strand	173	1	3
α-helix	174-191	18
α-helix	199-210	12
β-strand	217	1	3
α-helix	220-239	20

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	150-168	19
α-helix	174-191	18
α-helix	199-211	13
α-helix	220-239	20

Chain E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-168	19
β-strand	173	1	4
α-helix	174-189	16
α-helix	199-210	12
α-helix	213	1
β-strand	217	1	4
α-helix	220-239	20

Chain G: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	150-167	18
β-strand	173	1	6
α-helix	174-191	18
α-helix	199-210	12
β-strand	217	1	6
α-helix	220-239	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VPS28	A, B, C, D, E, F, G	protein	94	Saccharomyces cerevisiae	Q02767 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>2G3K_1 Vacuolar protein sorting-associated protein VPS28 (chains A, B, C, D, E, F, G)
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIV
RINKLSIGDTLTETQIRELLFDLELAYKSFYALL

Primary citation

The crystal structure of the C-terminal domain of Vps28 reveals a conserved surface required for Vps20 recruitment. Pineda-Molina, E., Belrhali, H., Piefer, A.J. et al. Traffic (2006) 7:1007-1016. DOI 10.1111/j.1600-0854.2006.00440.x · PubMed

Other PDB entries of the same protein (UniProt Q02767 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J9U 2.0 Å, 2 Angstrom X-ray structure of the yeast ESCRT-I Vps28 C-terminus in complex with the…
2J9V 2.0 Å, 2 Angstrom X-ray structure of the yeast ESCRT-I Vps28 C-terminus
2F6M 2.1 Å, Structure of a Vps23-C:Vps28-N subcomplex
2P22 2.7 Å, Structure of the Yeast ESCRT-I Heterotetramer Core
2F66 2.8 Å, Structure of the ESCRT-I endosomal trafficking complex
2CAZ 3.6 Å, ESCRT-I core

Browse structure collections

About this viewer

MolViewer shows 2G3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.