Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2. Determined by X-ray diffraction at 0.92 Å resolution. Released 11 Apr 2006.
Explore 2G6F in 3D Show helices and sheets RCSB PDB PDBe
2G6F contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-13 | 4 | 1 |
| β-strand | 17 | 1 | 2 |
| β-strand | 24 | 1 | 1 |
| β-strand | 27 | 1 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 43-48 | 6 | 1 |
| β-strand | 51-56 | 6 | 1 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-62 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho guanine nucleotide exchange factor 7 | X | protein | 59 | Rattus norvegicus | O55043 (AlphaFold model) |
>2G6F_1 Rho guanine nucleotide exchange factor 7 (chains X) GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
| ID | Name | Formula | Copies |
|---|---|---|---|
| NCO | Cobalt hexammine(iii) | Co H18 N6 | 1 |
Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2. Hoelz, A., Janz, J.M., Lawrie, S.D. et al. J Mol Biol (2006) 358:509-522. DOI 10.1016/j.jmb.2006.02.027 · PubMed
Other PDB entries of the same protein (UniProt O55043 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2G6F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.