2GEE: Hypothetical protein

Crystal Structure of Human Type III Fibronectin Extradomain B and Domain 8. Determined by X-ray diffraction at 2.01 Å resolution. Released 17 Oct 2006.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,827
Mol. weight: 22.1 kDa
Released: 17 Oct 2006

Explore 2GEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GEE contains 7 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	98-103	6	1
β-strand	110-115	6	1
β-strand	124-131	8	2
β-strand	139-144	6	2
β-strand	149-152	4	1
α-helix	155-156	2
β-strand	160-168	9	2
β-strand	173	1	2
α-helix	174-176	3
β-strand	177-182	6	2
α-helix	183-187	5
β-strand	189-197	9	3
β-strand	200-206	7	3
α-helix	207-208	2
β-strand	215-222	8	4
α-helix	226-228	3
β-strand	230-234	5	4
β-strand	240-243	4	3
α-helix	246-247	2
β-strand	251-260	10	4
β-strand	263-264	2	4
α-helix	265-267	3
β-strand	268-273	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hypothetical protein	A	protein	203	Homo sapiens	P02751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GEE_1 hypothetical protein (chains A)
MGSSHHHHHHSSGLVPRGSHMEVPQPTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVA
AGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVYTVKNGGESTPTTLTQQTAVPPPTDL
RFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE
YVVSVSSVYEQHESTPLRGRQKT

Primary citation

Structural insights into fibronectin type III domain-mediated signaling. Bencharit, S., Cui, C.B., Siddiqui, A. et al. J Mol Biol (2007) 367:303-309. DOI 10.1016/j.jmb.2006.10.017 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2GEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.