2GIV: Human MYST histone acetyltransferase 1

Name: PDB 2GIV: Human MYST histone acetyltransferase 1
Published: 2006-04-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Human MYST histone acetyltransferase 1. Determined by X-ray diffraction at 1.94 Å resolution. Released 11 Apr 2006.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,344
Mol. weight: 35.37 kDa
Ligands: ACO, ZN
Released: 11 Apr 2006

Explore 2GIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GIV contains 11 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	14-17	4	1
α-helix	26-28	3
β-strand	33-36	4	1
β-strand	43-44	2	1
α-helix	47-56	10
β-strand	65-70	6	2
β-strand	73-79	7	2
α-helix	84-95	12
β-strand	110-118	9	2
β-strand	123-132	10	2
β-strand	139-141	3	3
β-strand	144-146	3	2
α-helix	148-150	3
α-helix	155-169	15
β-strand	174	1	4
β-strand	175-176	2	3
α-helix	177	1
α-helix	180-181	2
α-helix	182-200	19
α-helix	209-216	8
β-strand	218	1	4
α-helix	220-229	10
β-strand	233-236	4	5
β-strand	239-242	4	5
α-helix	267-269	3
β-strand	270	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable histone acetyltransferase MYST1	A	protein	295	Homo sapiens	Q9H7Z6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GIV_1 Probable histone acetyltransferase MYST1 (chains A)
MGSSHHHHHHSSGLVPRGSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCL
KYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHK
TLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIA
FSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLENLRDFRGTLSIKDLSQMTSITQN
DIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK

Ligands and cofactors

ID	Name	Formula	Copies
ACO	Acetyl coenzyme *a	C23 H38 N7 O17 P3 S	1
ZN	Zinc ion	Zn	1

Water and common crystallization additives (CL) are not listed.

Primary citation

The Crystal Structure of Human MYST histone acetyltransferase 1 in complex with acetylcoenzyme A. Wu, H., Min, J., Loppnau, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H7Z6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

29UU 1.3 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor example-41
9OOA 1.39 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7
29UT 1.4 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 2
2PQ8 1.45 Å, MYST histone acetyltransferase 1
9OOF 1.68 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 10e
29TM 1.7 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor bay-7728
6OIN 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor CTX-124143
6OIO 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 60
6OIQ 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 63
6OWI 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 85
5WCI 1.78 Å, Human MYST histone acetyltransferase 1
29TN 1.8 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 38

Browse structure collections

About this viewer

MolViewer shows 2GIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.