Karyopherin Beta2/Transportin-M9NLS. Determined by X-ray diffraction at 3.05 Å resolution. Released 24 Oct 2006.
Explore 2H4M in 3D Show helices and sheets RCSB PDB PDBe
2H4M contains 127 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-12 | 4 | |
| α-helix | 17-20 | 4 | |
| α-helix | 29-34 | 6 | |
| α-helix | 45-50 | 6 | |
| α-helix | 51-55 | 5 | |
| α-helix | 62-75 | 14 | |
| α-helix | 88-97 | 10 | |
| α-helix | 104-119 | 16 | |
| α-helix | 129-136 | 8 | |
| α-helix | 142-158 | 17 | |
| α-helix | 162-164 | 3 | |
| α-helix | 165-168 | 4 | |
| α-helix | 172-181 | 10 | |
| α-helix | 188-199 | 12 | |
| α-helix | 207-211 | 5 | |
| α-helix | 213-223 | 11 | |
| α-helix | 229-245 | 17 | |
| α-helix | 247-249 | 3 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-265 | 12 | |
| α-helix | 270-284 | 15 | |
| α-helix | 289-293 | 5 | |
| α-helix | 294-296 | 3 | |
| α-helix | 297-306 | 10 | |
| α-helix | 312-318 | 7 | |
| α-helix | 375-390 | 16 | |
| α-helix | 391-394 | 4 | |
| α-helix | 395-405 | 11 | |
| α-helix | 411-432 | 22 | |
| α-helix | 433-435 | 3 | |
| α-helix | 436-446 | 11 | |
| α-helix | 452-463 | 12 | |
| α-helix | 466-471 | 6 | |
| α-helix | 478-488 | 11 | |
| α-helix | 494-511 | 18 | |
| α-helix | 512-518 | 7 | |
| α-helix | 519-532 | 14 | |
| α-helix | 535-552 | 18 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-575 | 17 | |
| α-helix | 583-596 | 14 | |
| α-helix | 598-601 | 4 | |
| α-helix | 602-628 | 27 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-655 | 17 | |
| α-helix | 656-659 | 4 | |
| α-helix | 660-664 | 5 | |
| α-helix | 668-675 | 8 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 719-721 | 3 | |
| α-helix | 722-739 | 18 | |
| α-helix | 740-746 | 7 | |
| α-helix | 748-758 | 11 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-803 | 14 | |
| β-strand | 804 | 1 | 1 |
| α-helix | 805-806 | 2 | |
| α-helix | 808-821 | 14 | |
| α-helix | 826-829 | 4 | |
| α-helix | 832-840 | 9 | |
| α-helix | 847-864 | 18 | |
| α-helix | 866-872 | 7 | |
| α-helix | 878-888 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-34 | 9 | |
| α-helix | 47-53 | 7 | |
| α-helix | 62-74 | 13 | |
| α-helix | 87-89 | 3 | |
| α-helix | 91-97 | 7 | |
| α-helix | 104-119 | 16 | |
| α-helix | 129-136 | 8 | |
| α-helix | 142-156 | 15 | |
| α-helix | 173-175 | 3 | |
| α-helix | 176-179 | 4 | |
| α-helix | 180-183 | 4 | |
| α-helix | 188-199 | 12 | |
| α-helix | 207-210 | 4 | |
| α-helix | 213-222 | 10 | |
| α-helix | 229-245 | 17 | |
| α-helix | 247-250 | 4 | |
| α-helix | 255-265 | 11 | |
| α-helix | 270-283 | 14 | |
| α-helix | 289-293 | 5 | |
| α-helix | 297-307 | 11 | |
| α-helix | 312-318 | 7 | |
| α-helix | 375-390 | 16 | |
| α-helix | 391-394 | 4 | |
| α-helix | 395-406 | 12 | |
| α-helix | 411-425 | 15 | |
| α-helix | 430-435 | 6 | |
| α-helix | 436-446 | 11 | |
| α-helix | 452-463 | 12 | |
| α-helix | 466-471 | 6 | |
| α-helix | 478-489 | 12 | |
| α-helix | 494-511 | 18 | |
| α-helix | 512-518 | 7 | |
| α-helix | 519-532 | 14 | |
| α-helix | 535-552 | 18 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-575 | 17 | |
| α-helix | 583-596 | 14 | |
| α-helix | 602-604 | 3 | |
| α-helix | 605-628 | 24 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-655 | 17 | |
| α-helix | 660-665 | 6 | |
| α-helix | 668-675 | 8 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 722-738 | 17 | |
| α-helix | 741-746 | 6 | |
| α-helix | 748-758 | 11 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-801 | 12 | |
| β-strand | 804 | 1 | 2 |
| α-helix | 808-821 | 14 | |
| α-helix | 826-829 | 4 | |
| α-helix | 832-840 | 9 | |
| α-helix | 847-873 | 27 | |
| α-helix | 878-888 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 269 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 269 | 1 | 2 |
| α-helix | 277-280 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transportin-1 | A, B | protein | 865 | Homo sapiens | Q92973 (AlphaFold model) |
| Heterogeneous nuclear ribonucleoprotein A1 | C, D | protein | 49 | Homo sapiens | P09651 (AlphaFold model) |
>2H4M_1 Transportin-1 (chains A, B) MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIGGSGGSGDTISDWNLRKCSAAALDV LANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQ CLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFA TLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQML MPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAML NNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQ SSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQP YIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIR DNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVG DENWRRFSDQFPLPLKERLAAFYGV
>2H4M_2 Heterogeneous nuclear ribonucleoprotein A1 (chains C, D) GGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY
Rules for nuclear localization sequence recognition by karyopherin beta 2. Lee, B.J., Cansizoglu, A.E., Louis, T.H. et al. Cell (2006) 126:543-558. DOI 10.1016/j.cell.2006.05.049 · PubMed
Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2H4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.