2H51: Human caspase-1

Crystal structure of human caspase-1 (Glu390->Asp and Arg286->Lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-VAD-FMK). Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Mar 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,283
Mol. weight: 30.56 kDa
Released: 11 Mar 2008

Explore 2H51 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H51 contains 10 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	132-135	4
α-helix	138-144	7
β-strand	152	1	1
β-strand	164-169	6	2
α-helix	182-195	14
β-strand	199-204	6	2
α-helix	208-219	12
α-helix	222-226	5
β-strand	230-235	6	2
β-strand	238-239	2	3
β-strand	242-244	3	3
α-helix	245	1
β-strand	255-256	2	3
α-helix	258-265	8
α-helix	271-273	3
β-strand	278-283	6	2
β-strand	289	1	4

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	327-331	5	2
β-strand	337	1	4
β-strand	340	1	5
β-strand	341-342	2	6
β-strand	346-347	2	6
α-helix	348-360	13
α-helix	366-376	11
β-strand	388-390	3	2
β-strand	397	1	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-1	A	protein	178	Homo sapiens	P29466 (AlphaFold model)
Caspase-1	B	protein	88	Homo sapiens	P29466 (AlphaFold model)
N-[(benzyloxy)carbonyl]-L-valyl-N-[(2S)-1-carboxy-4-fluoro-3-oxobutan-2-yl]-L-alaninamide	C	protein	5

Sequence of entity 1 (A), FASTA

>2H51_1 Caspase-1 (chains A)
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRR
TGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGI
REGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACKGDSPGVVWFKD

Sequence of entity 2 (B), FASTA

>2H51_2 Caspase-1 (chains B)
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS
FEQPDGRAQMPTTDRVTLTRCFYLFPGH

Sequence of entity 3 (C), FASTA

>2H51_3 N-[(benzyloxy)carbonyl]-L-valyl-N-[(2S)-1-carboxy-4-fluoro-3-oxobutan-2-yl]-L-alaninamide (chains C)
XVADX

Primary citation

An allosteric circuit in caspase-1. Datta, D., Scheer, J.M., Romanowski, M.J. et al. J Mol Biol (2008) 381:1157-1167. DOI 10.1016/j.jmb.2008.06.040 · PubMed

Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8WRA 1.45 Å, The Crystal Structure of CASP1 from Biortus
6BZ9 1.8 Å, Crystal structure of human caspase-1 in complex with Ac-FLTD-CMK
1SC3 1.8 Å, Crystal structure of the human caspase-1 C285A mutant in complex with malonate
2H54 1.8 Å, Crystal structure of human caspase-1 (Thr388->Ala) in complex with…
2HBQ 1.8 Å, Crystal structure of wildtype human caspase-1 in complex with…
3D6M 1.8 Å, Crystal structure of human caspase-1 with a naturally-occurring Lys319->Arg substitution…
6F6R 1.8 Å, Crystal structure of human Caspase-1 with N-{3-[1-((S)-2-Hydroxy-5-oxo-tetrahydro-furan-3…
1RWX 1.85 Å, Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-b…
2H4Y 1.9 Å, Crystal structure of human caspase-1 (Arg286->Lys) in complex with…
2HBZ 1.9 Å, Crystal structure of human caspase-1 (Arg286->Ala, Glu390->Ala) in complex with…
3D6F 1.9 Å, Crystal structure of human caspase-1 with a naturally-occurring Arg240->Gln substitution…
6PZP 1.94 Å, Crystal structure of caspase-1 in complex with VX-765

Browse structure collections

About this viewer

MolViewer shows 2H51 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.