2HZS: Mediator head submodule Med8C/18/20

Structure of the Mediator head submodule Med8C/18/20. Determined by X-ray diffraction at 2.7 Å resolution. Released 12 Sept 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Saccharomyces cerevisiae
Chains: 12
Atoms: 14,086
Mol. weight: 240.87 kDa
Released: 12 Sept 2006

Explore 2HZS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HZS contains 72 α-helices and 106 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-22	7
β-strand	30-32	3	1
β-strand	36-44	9	1
β-strand	56-63	8	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-124	9	1
β-strand	128-131	4	1
β-strand	136-145	10	1
β-strand	147-157	11	1
α-helix	164-176	13
β-strand	183-185	3	1
α-helix	196-208	13

Chain B: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	1
β-strand	52	1	2
β-strand	57	1	3
β-strand	58	1	2
β-strand	62	1	4
β-strand	64-68	5	1
α-helix	72-74	3
α-helix	75-78	4
α-helix	161-163	3
β-strand	164-169	6	1
α-helix	171-174	4
β-strand	181-195	15	1
α-helix	200-206	7
β-strand	209-223	15	1
α-helix	225-227	3
β-strand	229-237	9	1
β-strand	242-245	4	1
β-strand	250-259	10	1
α-helix	265-282	18
β-strand	289	1	1
α-helix	290-292	3
α-helix	293-296	4
β-strand	299	1	4
β-strand	304-305	2	5

Chain C: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	6
α-helix	16-22	7
β-strand	30-32	3	6
β-strand	37-44	8	6
β-strand	56-63	8	6
β-strand	67-73	7	6
β-strand	76-81	6	6
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-124	9	6
β-strand	128-131	4	6
β-strand	135-143	9	6
β-strand	148-157	10	6
α-helix	164-176	13
β-strand	183-185	3	6
α-helix	196-208	13

Chain D: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	6
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	6
β-strand	52	1	7
β-strand	58	1	7
β-strand	62	1	8
β-strand	64-68	5	6
α-helix	72-75	4
α-helix	161-163	3
β-strand	164-169	6	6
α-helix	171-174	4
β-strand	181-195	15	6
α-helix	200-206	7
β-strand	209-223	15	6
α-helix	225-227	3
β-strand	229-239	11	6
β-strand	242-244	3	6
β-strand	250-259	10	6
α-helix	265-282	18
β-strand	289	1	6
α-helix	290-292	3
α-helix	293-296	4
β-strand	299	1	8

Chain E: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	9
α-helix	16-22	7
β-strand	30-32	3	9
β-strand	37-44	8	9
β-strand	51	1	3
β-strand	56-62	7	9
β-strand	68-73	6	9
β-strand	76-81	6	9
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-124	9	9
β-strand	128-132	5	9
β-strand	135-144	10	9
β-strand	147-157	11	9
α-helix	163-176	14
β-strand	183-185	3	9
α-helix	196-208	13

Chain F: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	9
α-helix	16-27	12
β-strand	32-43	12	9
β-strand	62	1	10
β-strand	64-68	5	9
α-helix	72-74	3
β-strand	76	1	11
β-strand	146	1	11
β-strand	150-151	2	5
α-helix	154-156	3
α-helix	160-163	4
β-strand	164-169	6	9
α-helix	170-172	3
β-strand	181-195	15	9
α-helix	200-206	7
β-strand	209-223	15	9
α-helix	225-227	3
β-strand	229-239	11	9
β-strand	242-245	4	9
β-strand	250-259	10	9
α-helix	265-282	18
β-strand	289	1	9
α-helix	290-292	3
α-helix	293-296	4
β-strand	299	1	10

Chain G: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	12
α-helix	16-22	7
α-helix	25-27	3
β-strand	30-32	3	12
β-strand	37-44	8	12
β-strand	56-62	7	12
β-strand	68-73	6	12
β-strand	76-81	6	12
α-helix	84-86	3
α-helix	89-93	5
α-helix	104-111	8
β-strand	116-124	9	12
β-strand	128-131	4	12
β-strand	136-144	9	12
β-strand	147-157	11	12
α-helix	164-176	13
β-strand	183-185	3	12
α-helix	196-208	13

Chain H: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	12
α-helix	13-15	3
α-helix	16-27	12
β-strand	32-43	12	12
β-strand	52	1	13
β-strand	58	1	13
β-strand	62	1	14
β-strand	64-68	5	12
α-helix	72-74	3
α-helix	75-78	4
α-helix	80-82	3
α-helix	161-163	3
β-strand	164-169	6	12
α-helix	171-174	4
β-strand	181-195	15	12
α-helix	200-206	7
β-strand	209-223	15	12
α-helix	225-227	3
β-strand	229-237	9	12
β-strand	239	1	1
β-strand	242-244	3	1
β-strand	245	1	12
β-strand	250-259	10	12
α-helix	265-281	17
β-strand	289	1	12
α-helix	290-292	3
α-helix	293-296	4
β-strand	299	1	14

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II mediator complex subunit 20	A, C, E, G	protein	209	Saccharomyces cerevisiae	P34162 (AlphaFold model)
RNA polymerase II mediator complex subunit 18	B, D, F, H	protein	306	Saccharomyces cerevisiae	P32585 (AlphaFold model)
RNA polymerase II mediator complex subunit 8	I, J, K, L	protein	27	Saccharomyces cerevisiae	P38304 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>2HZS_1 RNA polymerase II mediator complex subunit 20 (chains A, C, E, G)
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSIT
FHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQL
IKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKE
YKTSSDSLGPDTSNEICDLAYQYVRALEL

Sequence of entity 2 (B, D, F, H), FASTA

>2HZS_2 RNA polymerase II mediator complex subunit 18 (chains B, D, F, H)
VQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEP
NRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNS
TNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVS
MQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEA
GNSQITSGGFLLKAYINVSRGTDIDRINYTETVLMNLKKELQGYIELSVPDRQSMDSRVA
HGNILI

Sequence of entity 3 (I, J, K, L), FASTA

>2HZS_3 RNA polymerase II mediator complex subunit 8 (chains I, J, K, L)
SKPSKPFNVDDVLKFTFTGEKHHHHHH

Primary citation

Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Lariviere, L., Geiger, S., Hoeppner, S. et al. Nat Struct Mol Biol (2006) 13:895-901. DOI 10.1038/nsmb1143 · PubMed

Other PDB entries of the same protein (UniProt P34162 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HZM 2.4 Å, Structure of the Mediator head subcomplex Med18/20
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
4GWP 4.2 Å, Structure of the Mediator Head Module from S. cerevisiae
3RJ1 4.3 Å, Architecture of the Mediator Head module
7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
4GWQ 4.5 Å, Structure of the Mediator Head Module from S. cerevisiae in complex with the…
7UIF 4.6 Å, Mediator-PIC Early (Core B)
5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator

Browse structure collections

About this viewer

MolViewer shows 2HZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.