2I4K: PX domain of Sorting Nexin 1

Solution Structure of the PX domain of Sorting Nexin 1. Determined by solution NMR. Released 3 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,035
Mol. weight: 14.7 kDa
Released: 3 Oct 2006

Explore 2I4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I4K contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	13	1	2
β-strand	22	1	2
β-strand	26	1	1
β-strand	42	1	1
α-helix	46-58	13
α-helix	93-110	18
α-helix	112-115	4
α-helix	118-121	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-1	A	protein	128	Homo sapiens	Q13596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2I4K_1 Sorting nexin-1 (chains A)
QFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKH
SQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDV
REFLEKEE

Primary citation

Determinants of the Endosomal Localization of Sorting Nexin 1. Zhong, Q., Watson, M.J., Lazar, C.S. et al. Mol Cell Biol (2005) 16:2049-2057. DOI 10.1091/mbc.E04-06-0504 · PubMed

Other PDB entries of the same protein (UniProt Q13596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A1G 2.5 Å, Structure of the SNX1-SNX5 complex
4FZS 2.8 Å, Structure of human SNX1 BAR domain
8ABQ 2.81 Å, Structure of the SNX1-SNX5 complex, Pt derivative
8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat

Browse structure collections

About this viewer

MolViewer shows 2I4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.