8ABQ: SNX1-SNX5 complex, Pt derivative

Structure of the SNX1-SNX5 complex, Pt derivative. Determined by X-ray diffraction at 2.81 Å resolution. Released 21 Jun 2023.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,660
Mol. weight: 103.65 kDa
Ligands: PT
Released: 21 Jun 2023

Explore 8ABQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ABQ contains 25 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	307-356	50
α-helix	362-388	27
α-helix	389-393	5
α-helix	394-397	4
α-helix	399-437	39
α-helix	446-511	66
α-helix	515-519	5

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	308-356	49
α-helix	361-387	27
α-helix	388-393	6
α-helix	394-435	42
α-helix	436-438	3
α-helix	443-519	77

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	208-252	45
α-helix	255-257	3
α-helix	260-287	28
α-helix	288-292	5
α-helix	293-323	31
α-helix	345-402	58

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	208-252	45
α-helix	260-287	28
α-helix	288-292	5
α-helix	293-323	31
α-helix	347-397	51
α-helix	398-400	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-1	A, B	protein	222	Homo sapiens	Q13596 (AlphaFold model)
Sorting nexin-5	C, D	protein	210	Homo sapiens	Q9Y5X3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8ABQ_1 Sorting nexin-1 (chains A, B)
KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIR
FEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS

Sequence of entity 2 (C, D), FASTA

>8ABQ_2 Sorting nexin-5 (chains C, D)
DEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSL
ALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTK
ALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRK
NLIEMSELEIKHARNNVSLLQSCIDLFKNN

Ligands and cofactors

ID	Name	Formula	Copies
PT	Platinum (II) ion	Pt	8

Primary citation

Architecture of the ESCPE-1 membrane coat. Lopez-Robles, C., Scaramuzza, S., Astorga-Simon, E.N. et al. Nat Struct Mol Biol (2023) 30:958-969. DOI 10.1038/s41594-023-01014-7 · PubMed

Other PDB entries of the same protein (UniProt Q13596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A1G 2.5 Å, Structure of the SNX1-SNX5 complex
4FZS 2.8 Å, Structure of human SNX1 BAR domain
8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat
2I4K Solution Structure of the PX domain of Sorting Nexin 1

Browse structure collections

About this viewer

MolViewer shows 8ABQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.