4FZS: Human SNX1 BAR domain

Structure of human SNX1 BAR domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 10 Jul 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,341
Mol. weight: 53.05 kDa
Released: 10 Jul 2013

Explore 4FZS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FZS contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	307-356	50
α-helix	361-385	25
α-helix	388-440	53
α-helix	443-483	41
α-helix	489-511	23

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	309-356	48
α-helix	361-379	19
α-helix	389-432	44
α-helix	444-476	33
α-helix	489-514	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-1	A, B	protein	224	Homo sapiens	Q13596 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4FZS_1 Sorting nexin-1 (chains A, B)
GAKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSE
DNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQ
RWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEV
IRFEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS

Primary citation

Molecular insight into vesicle-to-tubule membrane remodeling by SNX-BAR proteins. van Weering, J.R.T., Sessions, R.B., Traer, C.J. et al. To be published.

Other PDB entries of the same protein (UniProt Q13596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A1G 2.5 Å, Structure of the SNX1-SNX5 complex
8ABQ 2.81 Å, Structure of the SNX1-SNX5 complex, Pt derivative
8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat
2I4K Solution Structure of the PX domain of Sorting Nexin 1

Browse structure collections

About this viewer

MolViewer shows 4FZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.