8A1G: SNX1-SNX5 complex

Structure of the SNX1-SNX5 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Jun 2023.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,764
Mol. weight: 102.51 kDa
Ligands: POL
Released: 14 Jun 2023

Explore 8A1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A1G contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	307-357	51
α-helix	361-387	27
α-helix	388-393	6
α-helix	394-438	45
α-helix	443-519	77

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	308-357	50
α-helix	361-388	28
α-helix	389-393	5
α-helix	394-437	44
α-helix	443-519	77

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	208-255	48
α-helix	260-287	28
α-helix	288-292	5
α-helix	293-323	31
α-helix	345-402	58

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	207-256	50
α-helix	260-287	28
α-helix	288-292	5
α-helix	293-324	32
α-helix	344-402	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-1	A, B	protein	222	Homo sapiens	Q13596 (AlphaFold model)
Sorting nexin-5	C, D	protein	210	Homo sapiens	Q9Y5X3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8A1G_1 Sorting nexin-1 (chains A, B)
KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIR
FEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS

Sequence of entity 2 (C, D), FASTA

>8A1G_2 Sorting nexin-5 (chains C, D)
DEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSL
ALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTK
ALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRK
NLIEMSELEIKHARNNVSLLQSCIDLFKNN

Ligands and cofactors

ID	Name	Formula	Copies
POL	N-propanol	C3 H8 O	7

Primary citation

Architecture of the ESCPE-1 membrane coat. Lopez-Robles, C., Scaramuzza, S., Astorga-Simon, E.N. et al. Nat Struct Mol Biol (2023) 30:958-969. DOI 10.1038/s41594-023-01014-7 · PubMed

Other PDB entries of the same protein (UniProt Q13596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FZS 2.8 Å, Structure of human SNX1 BAR domain
8ABQ 2.81 Å, Structure of the SNX1-SNX5 complex, Pt derivative
8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat
2I4K Solution Structure of the PX domain of Sorting Nexin 1

Browse structure collections

About this viewer

MolViewer shows 8A1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.