Crystal structure of the bric-a-brac (BTB) domain of human BACH1. Determined by X-ray diffraction at 2.44 Å resolution. Released 31 Oct 2006.
Explore 2IHC in 3D Show helices and sheets RCSB PDB PDBe
2IHC contains 23 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| α-helix | 16-30 | 15 | |
| β-strand | 36-40 | 5 | 2 |
| β-strand | 43-47 | 5 | 2 |
| α-helix | 49-55 | 7 | |
| β-strand | 56 | 1 | 3 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-74 | 4 | 2 |
| α-helix | 81-93 | 13 | |
| β-strand | 95-99 | 5 | 4 |
| α-helix | 103-113 | 11 | |
| β-strand | 115 | 1 | 3 |
| α-helix | 120-124 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 4 |
| α-helix | 16-30 | 15 | |
| β-strand | 36-40 | 5 | 5 |
| β-strand | 43-47 | 5 | 5 |
| α-helix | 49-55 | 7 | |
| β-strand | 56 | 1 | 6 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-74 | 4 | 5 |
| α-helix | 81-93 | 13 | |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 103-113 | 11 | |
| β-strand | 115 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 7 |
| α-helix | 16-30 | 15 | |
| β-strand | 36-40 | 5 | 8 |
| β-strand | 43-47 | 5 | 8 |
| α-helix | 49-55 | 7 | |
| β-strand | 56 | 1 | 9 |
| α-helix | 57-63 | 7 | |
| β-strand | 71-74 | 4 | 8 |
| α-helix | 81-93 | 13 | |
| β-strand | 95-99 | 5 | 10 |
| α-helix | 103-113 | 11 | |
| β-strand | 115 | 1 | 9 |
| α-helix | 120-123 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 10 |
| α-helix | 16-30 | 15 | |
| β-strand | 36-40 | 5 | 11 |
| β-strand | 43-47 | 5 | 11 |
| α-helix | 49-55 | 7 | |
| β-strand | 56 | 1 | 12 |
| α-helix | 57-63 | 7 | |
| β-strand | 72-74 | 3 | 11 |
| α-helix | 81-93 | 13 | |
| β-strand | 95-99 | 5 | 7 |
| α-helix | 103-113 | 11 | |
| β-strand | 115 | 1 | 12 |
| α-helix | 120-125 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription regulator protein BACH1 | A, B, C, D | protein | 124 | Homo sapiens | O14867 (AlphaFold model) |
>2IHC_1 Transcription regulator protein BACH1 (chains A, B, C, D) SMSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIV GQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQ FLKF
Crystal structure of the bric-a-brac (BTB) domain of human BACH1. Amos, A.L., Turnbull, A.P., Bunkoczi, G. et al. To be published.
Other PDB entries of the same protein (UniProt O14867 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.