2IHC: Bric-a-brac (BTB) domain of human BACH1

Crystal structure of the bric-a-brac (BTB) domain of human BACH1. Determined by X-ray diffraction at 2.44 Å resolution. Released 31 Oct 2006.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,415
Mol. weight: 56.23 kDa
Released: 31 Oct 2006

Explore 2IHC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IHC contains 23 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	16-30	15
β-strand	36-40	5	2
β-strand	43-47	5	2
α-helix	49-55	7
β-strand	56	1	3
α-helix	57-63	7
β-strand	71-74	4	2
α-helix	81-93	13
β-strand	95-99	5	4
α-helix	103-113	11
β-strand	115	1	3
α-helix	120-124	5

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	4
α-helix	16-30	15
β-strand	36-40	5	5
β-strand	43-47	5	5
α-helix	49-55	7
β-strand	56	1	6
α-helix	57-63	7
β-strand	71-74	4	5
α-helix	81-93	13
β-strand	95-99	5	1
α-helix	103-113	11
β-strand	115	1	6

Chain C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	7
α-helix	16-30	15
β-strand	36-40	5	8
β-strand	43-47	5	8
α-helix	49-55	7
β-strand	56	1	9
α-helix	57-63	7
β-strand	71-74	4	8
α-helix	81-93	13
β-strand	95-99	5	10
α-helix	103-113	11
β-strand	115	1	9
α-helix	120-123	4

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	10
α-helix	16-30	15
β-strand	36-40	5	11
β-strand	43-47	5	11
α-helix	49-55	7
β-strand	56	1	12
α-helix	57-63	7
β-strand	72-74	3	11
α-helix	81-93	13
β-strand	95-99	5	7
α-helix	103-113	11
β-strand	115	1	12
α-helix	120-125	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription regulator protein BACH1	A, B, C, D	protein	124	Homo sapiens	O14867 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2IHC_1 Transcription regulator protein BACH1 (chains A, B, C, D)
SMSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIV
GQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQ
FLKF

Primary citation

Crystal structure of the bric-a-brac (BTB) domain of human BACH1. Amos, A.L., Turnbull, A.P., Bunkoczi, G. et al. To be published.

Other PDB entries of the same protein (UniProt O14867 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GRA 1.47 Å, Homodimer of BACH1 BTB domain in complex with 2-Methyl-2,4-pentanediol
9GP5 1.9 Å, Homodimer of BACH1 F9A mutant BTB domain
9GR9 2.25 Å, Homodimer of BACH1 BTB domain
8UBT 3.1 Å, Structure of SCF-FBXL17-BACH1BTB E3 ligase complex
8S7D 3.2 Å, Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution
8UAH 3.3 Å, Structure of BACH1 BTB domain-bound FBXL17 ubiquitin ligase
8UA3 3.8 Å, Cryo-EM Structure of FBOX22-BACH1BTB
8UA6 3.9 Å, Cryo-EM Structure of SCF-FBOX22-BACH1BTB
8UBV 4.1 Å, Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex
29HH 4.2 Å, Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with…
8UBU 4.6 Å, Cryo-EM structure of dimeric SCF-FBXL17-BACH1BTB E3 ligase complex close conformation

Browse structure collections

About this viewer

MolViewer shows 2IHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.