2IZX: PDB entry 2IZX

Molecular Basis of AKAP Specificity for PKA Regulatory Subunits. Determined by X-ray diffraction at 1.3 Å resolution. Released 8 Nov 2006.

Method: X-ray diffraction
Resolution: 1.3 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 3
Atoms: 915
Mol. weight: 11.96 kDa
Ligands: DTD
Released: 8 Nov 2006

Explore 2IZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IZX contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-42	15

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-41	14

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-20	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Camp-dependent protein kinase type II-alpha regulatory subunit	A, B	protein	41	HOMO SAPIENS	P13861 (AlphaFold model)
Akap-is	C	protein	18	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A, B), FASTA

>2IZX_1 CAMP-DEPENDENT PROTEIN KINASE TYPE II-ALPHA REGULATORY SUBUNIT (chains A, B)
IQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR

Sequence of entity 2 (C), FASTA

>2IZX_2 AKAP-IS (chains C)
QIEYLAKQIVDNAIQQAK

Ligands and cofactors

ID	Name	Formula	Copies
DTD	Dithiane diol	C4 H8 O2 S2	2

Primary citation

Molecular Basis of Akap Specificity for Pka Regulatory Subunits. Gold, M.G., Lygren, B., Dokurno, P. et al. Mol Cell (2006) 24:383. DOI 10.1016/J.MOLCEL.2006.09.006 · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…

Browse structure collections

About this viewer

MolViewer shows 2IZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.