Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer. Determined by X-ray diffraction at 2.23 Å resolution. Released 11 Oct 2006.
Explore 2J6O in 3D Show helices and sheets RCSB PDB PDBe
2J6O contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 10 | 1 | 2 |
| β-strand | 17 | 1 | 3 |
| α-helix | 18-19 | 2 | |
| β-strand | 20 | 1 | 2 |
| α-helix | 24 | 1 | |
| β-strand | 25-26 | 2 | 1 |
| β-strand | 27-31 | 5 | 3 |
| β-strand | 37-42 | 6 | 3 |
| β-strand | 45-50 | 6 | 3 |
| α-helix | 51-53 | 3 | |
| β-strand | 54-56 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD2-associated protein | A | protein | 62 | HOMO SAPIENS | Q9Y5K6 (AlphaFold model) |
| T-cell surface antigen CD2 | C | protein | 10 | HOMO SAPIENS | P06729 (AlphaFold model) |
>2J6O_1 CD2-ASSOCIATED PROTEIN (chains A) MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE TE
>2J6O_2 T-CELL SURFACE ANTIGEN CD2 (chains C) KGPPLPRPRV
Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain. Moncalian, G., Cardenes, N., Deribe, Y.L. et al. J Biol Chem (2006) 281:38845. DOI 10.1074/JBC.M606411200 · PubMed
Other PDB entries of the same protein (UniProt Q9Y5K6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2J6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.