4X1V: 2nd SH3 domain from human CD2AP

Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1. Determined by X-ray diffraction at 1.58 Å resolution. Released 17 Feb 2016.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Homo sapiens
Chains: 2
Atoms: 681
Mol. weight: 9.43 kDa
Released: 17 Feb 2016

Explore 4X1V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X1V contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	112-115	4	1
β-strand	119	1	2
β-strand	126	1	1
α-helix	127-128	2
β-strand	129	1	2
β-strand	134-142	9	1
β-strand	145-150	6	1
β-strand	153-158	6	1
α-helix	159-161	3
β-strand	162-164	3	1
α-helix	165-166	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	83-86	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD2-associated protein	A	protein	65	Homo sapiens	Q9Y5K6 (AlphaFold model)
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1	B	protein	16	Homo sapiens	Q96P48 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4X1V_1 CD2-associated protein (chains A)
GPLGSKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVK
ELEVT

Sequence of entity 2 (B), FASTA

>4X1V_2 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (chains B)
RPTPRPVPMKRHIFRS

Primary citation

Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1. Rouka, E., Feller, S.M., Simister, P.C. To be published.

Other PDB entries of the same protein (UniProt Q9Y5K6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U23 1.11 Å, Atomic resolution crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in…
4WCI 1.65 Å, Crystal structure of the 1st SH3 domain from human CD2AP (CMS) in complex with a…
7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
2J6F 1.7 Å, N-terminal SH3 domain of cms (CD2AP human homolog) bound to cbl-B peptide
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
2J6O 2.23 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer
2J6K 2.77 Å, N-terminal SH3 domain of cms (CD2AP human homolog)
2J7I 2.9 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterodimer
2FEI Solution structure of the second SH3 domain of Human CMS protein

Browse structure collections

About this viewer

MolViewer shows 4X1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.