2J7I: CD2-associated protein

Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterodimer. Determined by X-ray diffraction at 2.9 Å resolution. Released 6 Nov 2006.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,142
Mol. weight: 17.06 kDa
Released: 6 Nov 2006

Explore 2J7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J7I contains 4 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	10	1	2
β-strand	17	1	3
β-strand	20	1	2
β-strand	25-26	2	1
β-strand	27-31	5	3
β-strand	37-41	5	3
β-strand	46-50	5	3
β-strand	54-56	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	4
β-strand	10	1	5
β-strand	17	1	4
α-helix	18-19	2
β-strand	20	1	5
β-strand	25-30	6	4
β-strand	37-42	6	4
β-strand	45-50	6	4
α-helix	51-53	3
β-strand	54-56	3	4

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	329-332	4

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	329-331	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD2-associated protein	A, B	protein	62	HOMO SAPIENS	Q9Y5K6 (AlphaFold model)
T-cell surface antigen CD2	C, D	protein	10	HOMO SAPIENS	P06729 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2J7I_1 CD2-ASSOCIATED PROTEIN (chains A, B)
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TE

Sequence of entity 2 (C, D), FASTA

>2J7I_2 T-CELL SURFACE ANTIGEN CD2 (chains C, D)
KGPPLPRPRV

Primary citation

Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain. Moncalian, G., Cardenes, N., Deribe, Y.L. et al. J Biol Chem (2006) 281:38845. DOI 10.1074/JBC.M606411200 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5K6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U23 1.11 Å, Atomic resolution crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in…
4X1V 1.58 Å, Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a…
4WCI 1.65 Å, Crystal structure of the 1st SH3 domain from human CD2AP (CMS) in complex with a…
7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
2J6F 1.7 Å, N-terminal SH3 domain of cms (CD2AP human homolog) bound to cbl-B peptide
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
2J6O 2.23 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer
2J6K 2.77 Å, N-terminal SH3 domain of cms (CD2AP human homolog)
2FEI Solution structure of the second SH3 domain of Human CMS protein

Browse structure collections

About this viewer

MolViewer shows 2J7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.