3U23: CD2-associated protein

Atomic resolution crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide from human RIN3. Determined by X-ray diffraction at 1.11 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 687
Mol. weight: 9.31 kDa
Released: 28 Dec 2011

Explore 3U23 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U23 contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	112-115	4	1
β-strand	119	1	2
β-strand	126	1	1
α-helix	127-128	2
β-strand	129	1	2
β-strand	134-142	9	1
β-strand	145-150	6	1
β-strand	153-158	6	1
α-helix	159-161	3
β-strand	162-164	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	459-462	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD2-associated protein	A	protein	65	Homo sapiens	Q9Y5K6 (AlphaFold model)
Ras and Rab interactor 3	B	protein	17	Homo sapiens	Q8TB24 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3U23_1 CD2-associated protein (chains A)
GPLGSKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVK
ELEVT

Sequence of entity 2 (B), FASTA

>3U23_2 Ras and Rab interactor 3 (chains B)
TAKQPPVPPPRKKRISX

Primary citation

Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3). Rouka, E., Simister, P.C., Janning, M. et al. J Biol Chem (2015) 290:25275-25292. DOI 10.1074/jbc.M115.637207 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5K6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X1V 1.58 Å, Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a…
4WCI 1.65 Å, Crystal structure of the 1st SH3 domain from human CD2AP (CMS) in complex with a…
7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
2J6F 1.7 Å, N-terminal SH3 domain of cms (CD2AP human homolog) bound to cbl-B peptide
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
2J6O 2.23 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer
2J6K 2.77 Å, N-terminal SH3 domain of cms (CD2AP human homolog)
2J7I 2.9 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterodimer
2FEI Solution structure of the second SH3 domain of Human CMS protein

Browse structure collections

About this viewer

MolViewer shows 3U23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.