2JAK: Human PP2A regulatory subunit B56g

Human PP2A regulatory subunit B56g. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Dec 2006.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,693
Mol. weight: 45.86 kDa
Released: 4 Dec 2006

Explore 2JAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JAK contains 25 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	40-48	9
α-helix	63-80	18
α-helix	91-103	13
α-helix	131-146	16
α-helix	152-155	4
α-helix	161-170	10
α-helix	176-192	17
α-helix	194-196	3
α-helix	197-212	16
α-helix	221-233	13
α-helix	235-236	2
α-helix	239-240	2
α-helix	241-246	6
α-helix	247-251	5
α-helix	252-255	4
α-helix	258-262	5
α-helix	264-277	14
α-helix	279-281	3
α-helix	282-291	10
α-helix	301-313	13
α-helix	317-335	19
α-helix	340-347	8
α-helix	348-351	4
α-helix	353-361	9
α-helix	363-366	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2A 56 kda regulatory subunit gamma isoform	A	protein	392	HOMO SAPIENS	Q13362 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JAK_1 SERINE/THREONINE-PROTEIN PHOSPHATASE 2A 56 KDA REGULATORY SUBUNIT GAMMA ISOFORM (chains A)
MHHHHHHSSGVDLGTENLYFQSMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQ
CCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLP
PSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLL
ELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEIL
GSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMA
LLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALY
YWNNEYIMSLISDNAAKILPIMFPSLYRNSKT

Primary citation

The Structure of the Pp2A Regulatory Subunit B56 Gamma: The Remaining Piece of the Pp2A Jigsaw Puzzle. Magnusdottir, A., Stenmark, P., Flodin, S. et al. Proteins (2009) 74:212. DOI 10.1002/PROT.22150 · PubMed

Other PDB entries of the same protein (UniProt Q13362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JJA 2.35 Å, Crystal structure of a PP2A B56gamma/BubR1 complex
6VRO 2.45 Å, The structure of the PP2A B56 subunit AIM1 complex
3FGA 2.7 Å, Structural Basis of PP2A and Sgo interaction
5K6S 2.79 Å, The structure of the PP2A B56 subunit BubR1 complex
5SWF 2.82 Å, The structure of the PP2A B56 subunit double phosphorylated BubR1 complex
5SW9 2.85 Å, The structure of the PP2A B56 subunit RepoMan complex
9GNJ 2.85 Å, Crystal structure of a PP2A B56gamma double phosphorylated BRCA2 complex
7OUF 3.0 Å, Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450
7OUG 3.1 Å, STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir
6OYL 3.15 Å, The structure of the PP2A B56 subunit KIF4A complex
6TOQ 3.16 Å, Crystal structure of a PP2A B56y/HTLV-1 integrase complex
9MF5 3.2 Å, CryoEM structure of the Protein Phosphatase 2A (Abeta-B56gamma-Calpha) holoenzyme complex

Browse structure collections

About this viewer

MolViewer shows 2JAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.