2JOD: PDB entry 2JOD

Pac1-Rshort N-terminal EC domain Pacap(6-38) complex. Determined by solution NMR. Released 22 May 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,118
Mol. weight: 16.03 kDa
Released: 22 May 2007

Explore 2JOD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JOD contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	30-44	15
β-strand	53	1	1
β-strand	57-58	2	2
β-strand	63-64	2	2
β-strand	68	1	1
β-strand	73-75	3	3
α-helix	76-77	2
β-strand	93-95	3	3
β-strand	97	1	4
β-strand	102	1	4

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	11-14	4
α-helix	18-22	5
α-helix	23-29	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pituitary adenylate cyclase-activating polypeptide type I receptor	A	protein	106	Homo sapiens	P41586 (AlphaFold model)
Pituitary adenylate cyclase-activating polypeptide	B	protein	33	Homo sapiens	P18509 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JOD_1 Pituitary adenylate cyclase-activating polypeptide type I receptor (chains A)
MGSMAHSDGIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVS
CPELFRIFNPDQDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESET

Sequence of entity 2 (B), FASTA

>2JOD_2 Pituitary adenylate cyclase-activating polypeptide (chains B)
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

Primary citation

Solution structure and mutational analysis of pituitary adenylate cyclase-activating polypeptide binding to the extracellular domain of PAC1-RS. Sun, C., Song, D., Davis-Taber, R.A. et al. Proc Natl Acad Sci U S A (2007) 104:7875-7880. DOI 10.1073/pnas.0611397104 · PubMed

Other PDB entries of the same protein (UniProt P41586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N94 1.8 Å, Crystal structure of human pituitary adenylate cyclase 1 Receptor-short N-terminal…
8E3X 2.3 Å, Cryo-EM structure of the PAC1R-PACAP27-Gs complex
7JQD 2.7 Å, Crystal Structure of PAC1r in complex with peptide antagonist
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9P94 3.0 Å, Cryo-EM structure of the PAC1sR-PACAP27-Gs complex
6P9Y 3.01 Å, PAC1 GPCR Receptor complex
9P93 3.2 Å, Cryo-EM structure of the PAC1sR-VIP-Gs complex
6M1I 3.5 Å, CryoEM structure of human PAC1 receptor in complex with PACAP38
6M1H 3.6 Å, CryoEM structure of human PAC1 receptor in complex with maxadilan
9P92 3.8 Å, Cryo-EM structure of the PAC1nR-VIP-Gs complex
6LPB 3.9 Å, Cryo-EM structure of the human PAC1 receptor coupled to an engineered heterotrimeric G…

Browse structure collections

About this viewer

MolViewer shows 2JOD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.