7JQD: PAC1r

Crystal Structure of PAC1r in complex with peptide antagonist. Determined by X-ray diffraction at 2.7 Å resolution. Released 24 Mar 2021.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Lutzomyia longipalpis
Chains: 2
Atoms: 984
Mol. weight: 16.25 kDa
Released: 24 Mar 2021

Explore 7JQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JQD contains 7 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	23-41	19
β-strand	54	1	1
α-helix	55-56	2
β-strand	57-58	2	2
β-strand	63-64	2	2
β-strand	67	1	1
β-strand	72-76	5	3
α-helix	80-84	5
β-strand	92-96	5	3
β-strand	97-98	2	4
β-strand	101-102	2	4
α-helix	103-105	3
β-strand	106	1	3
α-helix	109-113	5

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-17	15
α-helix	21-37	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pituitary adenylate cyclase-activating polypeptide type I receptor	A	protein	105	Homo sapiens	P41586 (AlphaFold model)
Peptide-43	B	protein	39	Lutzomyia longipalpis	P30659 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7JQD_1 Pituitary adenylate cyclase-activating polypeptide type I receptor (chains A)
GSMAHSDGIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSC
PELFRIFNPDQDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESET

Sequence of entity 2 (B), FASTA

>7JQD_2 Peptide-43 (chains B)
CDATCQFRKAIDDCARQAYHSSVFKACMKQKKKEWKAGX

Primary citation

Discovery of Selective Pituitary Adenylate Cyclase 1 Receptor (PAC1R) Antagonist Peptides Potent in a Maxadilan/PACAP38-Induced Increase in Blood Flow Pharmacodynamic Model. Hu, E., Hong, F.T., Aral, J. et al. J Med Chem (2021) 64:3427-3438. DOI 10.1021/acs.jmedchem.0c01396 · PubMed

Other PDB entries of the same protein (UniProt P41586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N94 1.8 Å, Crystal structure of human pituitary adenylate cyclase 1 Receptor-short N-terminal…
8E3X 2.3 Å, Cryo-EM structure of the PAC1R-PACAP27-Gs complex
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9P94 3.0 Å, Cryo-EM structure of the PAC1sR-PACAP27-Gs complex
6P9Y 3.01 Å, PAC1 GPCR Receptor complex
9P93 3.2 Å, Cryo-EM structure of the PAC1sR-VIP-Gs complex
6M1I 3.5 Å, CryoEM structure of human PAC1 receptor in complex with PACAP38
6M1H 3.6 Å, CryoEM structure of human PAC1 receptor in complex with maxadilan
9P92 3.8 Å, Cryo-EM structure of the PAC1nR-VIP-Gs complex
6LPB 3.9 Å, Cryo-EM structure of the human PAC1 receptor coupled to an engineered heterotrimeric G…
2JOD Pac1-Rshort N-terminal EC domain Pacap(6-38) complex

Browse structure collections

About this viewer

MolViewer shows 7JQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.